Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1092 bp · TkA03G517620|TK1151|cDNA
ATGGAGGCCATGATCGCAGAAAGGGTCGCATCCGCCCTAGTGGCTTACGAATTTGCAAACCCTCGAAATAACAATGGTGGTGGTGGTGGTGCCGGGAATCCGGGAGGAAACGGCGGAAACCCAAGGCCGTGTTCATACAAAGATTTTATGAATTGCAAGCCTCACAATTTCGCTGGAACCAGGGGTGTCATCGAACTGACACGCTGGTTTGAGAAGACGGAATCCGTCTTCCAGATCAGCAACTGTACAGCCGACTGCCA...
1092 bp · TkA03G517620|TK1151|CDS
ATGGAGGCCATGATCGCAGAAAGGGTCGCATCCGCCCTAGTGGCTTACGAATTTGCAAACCCTCGAAATAACAATGGTGGTGGTGGTGGTGCCGGGAATCCGGGAGGAAACGGCGGAAACCCAAGGCCGTGTTCATACAAAGATTTTATGAATTGCAAGCCTCACAATTTCGCTGGAACCAGGGGTGTCATCGAACTGACACGCTGGTTTGAGAAGACGGAATCCGTCTTCCAGATCAGCAACTGTACAGCCGACTGCCA...
Protein
Download Protein FASTA363 aa · TkA03G517620|TK1151|PROTEIN
MEAMIAERVASALVAYEFANPRNNNGGGGGAGNPGGNGGNPRPCSYKDFMNCKPHNFAGTRGVIELTRWFEKTESVFQISNCTADCQVKFSACTFMHAALSWWNTHVQTIGIVQANALTWAELKTMMIEEYCPRTELQKLEQELWNLTMQGSDIIGYTNRFNDLSVLCPGMVTPVAKKIERYIWGLSSEIQNSVTAFNPLTYESVKSVAIRMTDQAVRKGTMVPKAEPSREQHKRKPWNGNNNNNNNNSNSNSNSNNNTN...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA03G517620 |
|---|---|
| TK1151 ID | TkA03G517620 |
| OH-1004 ID | LXL04_004623 |
| Relationship / confidence | Multi Candidate From Tk1151 / Complex relationship |
| Protein identity (%) | 84.800 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 15.432Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA03G517620 |
|---|---|
| Location | Chr03:129857552-129860678 (+) |
| Description | Similar to TY3B-G: Transposon Ty3-G Gag-Pol polyprotein (Saccharomyces cerevisiae (strain ATCC 204508 / S288c) |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006310 DNA recombination Biological Process GO:0006508 proteolysis Biological Process GO:0015074 DNA integration Biological Process GO:0075523 viral translational frameshifting Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0003677 DNA binding Molecular Function GO:0003723 RNA binding Molecular Function GO:0003887 DNA-directed DNA polymerase activity Molecular Function GO:0003964 RNA-directed DNA polymerase activity Molecular Function GO:0004190 aspartic-type endopeptidase activity Molecular Function GO:0004523 RNA-DNA hybrid ribonuclease activity Molecular Function |
| KEGG gene cross-reference | sce:YGR109W-B These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF19259Ty3_capsid48-213 aaPF03732PEG10_N-capsid53-131 aaPF08704GCD14189-280 aaPF05053Menin231-274 aaPF22575Vir1p238-264 aaPF27939DUF8363292-343 aaPF00098zf-CCHC294-304 aaPF13696zf-CCHC_2294-299 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA03G517620 | PF19259 | Ty3_capsid | 48 | 213 | 3.5e-11 | 43.6 |
| TkA03G517620 | PF03732 | PEG10_N-capsid | 53 | 131 | 2.1e-08 | 35.1 |
| TkA03G517620 | PF08704 | GCD14 | 189 | 280 | 0.052 | 13.9 |
| TkA03G517620 | PF05053 | Menin | 231 | 274 | 3.7 | 6.5 |
| TkA03G517620 | PF22575 | Vir1p | 238 | 264 | 9.4 | 4.5 |
| TkA03G517620 | PF27939 | DUF8363 | 292 | 343 | 0.032 | 14.8 |
| TkA03G517620 | PF00098 | zf-CCHC | 294 | 304 | 4.3e-07 | 30.4 |
| TkA03G517620 | PF13696 | zf-CCHC_2 | 294 | 299 | 0.087 | 13.4 |
| TkA03G517620 | PF00098 | zf-CCHC | 321 | 338 | 4.3e-07 | 30.4 |
| TkA03G517620 | PF30379 | SLU7_N | 322 | 336 | 0.78 | 10.0 |
| TkA03G517620 | PF13696 | zf-CCHC_2 | 323 | 338 | 0.087 | 13.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.