TkA03G516940 | RubberDandelionOmics

Gene overview

TkA03G516940

Reference: TK1151 Chr: Chr03 Coordinates: 129695309-129698038 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2147 bp · TkA03G516940|TK1151|cDNA

TTATAAGTAAAAGTATATGCTTGTTTTATGGGCTTGGAGTTGGGAGTATTCTCTAATAACTTTTGCCGCGTAGGTAATGTACGCACTTTTTTGCCTCTTTGGAGGTTAACGCAAATCTAGAAGAACCACAATTCGGTGCCCCCAATTTCAGAGAGAAAGAGAGAACCACAGCGTCCAGCAGCAAAATAGTGGGAAATTCTTCTTTCAATCTTGCTCAACTCTCTCCTCTCGCTCATTCTGGGCATCAAAAAGTACATCGG...

CDS

Download CDS FASTA

1395 bp · TkA03G516940|TK1151|CDS

ATGGGGAAAGGTACCAAATGCAAGCCTGGGTCCCACCAGATATTCAAAGACAGAGCTAAGAACCGCGTGGAGGACCTCCATGGAATGTTCACAGATCTGCAATCAGCAAGGAAGGAGAGCCGTAGCATAGATGTAGCTGTTCTCGAAGAACAAGTCAACCAGATGCTCAAAGAATGGAAGAACGAACTCAACGAACCTTCCCCCGCTTCTTCCTTACAACAGGGTGCAAGTGTGGGGCCCTTCTCTCCTGACATAAGTAA...

Protein

Download Protein FASTA

464 aa · TkA03G516940|TK1151|PROTEIN

MGKGTKCKPGSHQIFKDRAKNRVEDLHGMFTDLQSARKESRSIDVAVLEEQVNQMLKEWKNELNEPSPASSLQQGASVGPFSPDISKLLQLCDEEDDATSVLAAPKPDPDNGQQSFPVNHTSQQQLQPFGSPSCVNNPGVTSQLDYFSFDLPPDFEQNFFTGFDDNTSPQITPAFLPTLSPPPSAFLGPKCALWDCPRPAQNWCSERPVHGWYPDYCSSLHAAIAQNEGRFGMTPVIRPKGIELKDTLLFAALSAKTQGK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G516940`
TK1151 ID	TkA03G516940
OH-1004 ID	LXL04_010284
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G516940

Location Chr03:129695309-129698038 (+)

Description Similar to VOZ1: Transcription factor VOZ1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g28520`	Transcriptional activator acting positively in the phytochrome B signaling pathway.	VOZ; isolation and characterization of novel vascular plant transcription factors with a one-zinc finger from Arabidopsis thaliana.2004 · DOI: 10.1093/pcp/pch101 The phytochrome-interacting vascular plant one-zinc finger1 and VOZ2 redundantly regulate flowering in Arabidopsis.2012 · DOI: 10.1105/tpc.112.101915
`At2g42400`	Transcriptional activator acting positively in the phytochrome B signaling pathway.	VOZ; isolation and characterization of novel vascular plant transcription factors with a one-zinc finger from Arabidopsis thaliana.2004 · DOI: 10.1093/pcp/pch101 The phytochrome-interacting vascular plant one-zinc finger1 and VOZ2 redundantly regulate flowering in Arabidopsis.2012 · DOI: 10.1105/tpc.112.101915

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010284 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009408 response to heat Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009585 red, far-red light phototransduction Biological Process

GO:0009631 cold acclimation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0048574 long-day photoperiodism, flowering Biological Process

GO:0048578 positive regulation of long-day photoperiodism, flowering Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G28520

ath:AT2G42400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.937

Rank 1 · TkA03G516940 · TK1151

Cytoplasm0.128

Rank 2 · TkA03G516940 · TK1151

Cell membrane0.050

Rank 3 · TkA03G516940 · TK1151

Endoplasmic reticulum0.042

Rank 4 · TkA03G516940 · TK1151

Plastid0.020

Rank 5 · TkA03G516940 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10199Adaptin_binding17-55 aa

PF28235VOZ_N22-58 aa

PF24978Death_Lrrd144-72 aa

PF29201VOZ_C183-378 aa

PF02365NAM242-360 aa

PF10199Adaptin_binding386-456 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G516940	`PF10199`	Adaptin_binding	17	55	0.013	17.0
TkA03G516940	`PF28235`	VOZ_N	22	58	1.3e-22	79.8
TkA03G516940	`PF24978`	Death_Lrrd1	44	72	0.38	11.7
TkA03G516940	`PF29201`	VOZ_C	183	378	6.7e-111	369.1
TkA03G516940	`PF02365`	NAM	242	360	0.00077	20.7
TkA03G516940	`PF10199`	Adaptin_binding	386	456	0.013	17.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SGQ0`	Arabidopsis thaliana	sp\|Q9SGQ0\|VOZ1_ARATH Transcription factor VOZ1	61.900%	Swiss-Prot	High
`Q9SLB9`	Arabidopsis thaliana	sp\|Q9SLB9\|VOZ2_ARATH Transcription factor VOZ2	50.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card