TkA03G516210 | RubberDandelionOmics

Gene overview

TkA03G516210

Reference: TK1151 Chr: Chr03 Coordinates: 129512803-129514075 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

980 bp · TkA03G516210|TK1151|cDNA

GGCAACAGCACCAAACTTGAAATCCGCGAACTGCTACAACAAAAAGCGGTTCCAGTGGCAATCGCATGTTTAGGATTTTAGGGTTAGGGTTTATCGACTGGGTACCAATTCACCAACCAATTGAACCTCGATTTCTTCATTTCAAAGGCGTCAATGGCGACAGTCAATGAAACGACAGCGGTGGAGATAGAAAACCAACAACCAGAACAGGGAGCAAGAGGAATAGTGAAGCGGAAGCCGGTGTTCGTGAAGGTAGGCGA...

CDS

Download CDS FASTA

483 bp · TkA03G516210|TK1151|CDS

ATGGCGACAGTCAATGAAACGACAGCGGTGGAGATAGAAAACCAACAACCAGAACAGGGAGCAAGAGGAATAGTGAAGCGGAAGCCGGTGTTCGTGAAGGTAGGCGACCTGAAACCTGGAACCAACGGCCATACCCTCGCCGTTAAGGTATTGACTGCGACGACGGTCTTAGACAAGAAATCACGCAATTCATCGTCATTCAGTAGCCGACCCGGCGCTGCTAATACTCGCATCGCTGAGTGCCTTATTGGTGATGAAAC...

Protein

Download Protein FASTA

160 aa · TkA03G516210|TK1151|PROTEIN

MATVNETTAVEIENQQPEQGARGIVKRKPVFVKVGDLKPGTNGHTLAVKVLTATTVLDKKSRNSSSFSSRPGAANTRIAECLIGDETGTILFTARNDQVDLMKAGNTVIIRNSKIDMFKGSMRLAVDKWGRIEVTEPASFTVKEDNNLSLVEYELVNVAE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G516210`
TK1151 ID	TkA03G516210
OH-1004 ID	LXL04_010263
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G516210

Location Chr03:129512803-129514075 (+)

Description Similar to At4g28440: Uncharacterized protein At4g28440

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g28440`	Uncharacterized protein At4g28440.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010263 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000724 double-strand break repair via homologous recombination Biological Process

GO:0010212 response to ionizing radiation Biological Process

GO:0005694 chromosome Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003729 mRNA binding Molecular Function

KEGG gene cross-reference

ath:AT4G28440

sso:SSO2364

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.713

Rank 1 · TkA03G516210 · TK1151

Cytoplasm0.338

Rank 2 · TkA03G516210 · TK1151

Mitochondrion0.059

Rank 3 · TkA03G516210 · TK1151

Cell membrane0.053

Rank 4 · TkA03G516210 · TK1151

Endoplasmic reticulum0.039

Rank 5 · TkA03G516210 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21473OB_Ssb-like37-134 aa

PF18821LPD792-140 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G516210	`PF21473`	OB_Ssb-like	37	134	6.7e-45	151.8
TkA03G516210	`PF18821`	LPD7	92	140	0.075	13.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O49453`	Arabidopsis thaliana	sp\|O49453\|Y4844_ARATH Uncharacterized protein At4g28440	74.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card