LXL04_010263 | RubberDandelionOmics

Gene overview

LXL04_010263

Reference: OH-1004 Chr: Chr02 Coordinates: 143473518-143474272 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

483 bp · LXL04_010263|LXL04_010263|OH1004|cDNA

ATGGCGACAGTCAATGAAACGACAGCGGTGGAGATAGAAAACCAACAACCAGAACAGGGAGCAAGAGGAATAGTGAAGCGGAAGCCGGTGTTCGTGAAGGTAGGCGACCTGAAACCTGGAACCAACGGCCATACCCTCGCCGTTAAGGTATTGACTGCGACGACGGTCTTAGACAAGAAATCACGCAATTCATCGTCATTCAGTAGCCGACCCGGCGCTGCTAATACTCGCATCGCTGAGTGCCTTATTGGTGATGAAAC...

CDS

Download CDS FASTA

483 bp · LXL04_010263|LXL04_010263|OH1004|CDS

ATGGCGACAGTCAATGAAACGACAGCGGTGGAGATAGAAAACCAACAACCAGAACAGGGAGCAAGAGGAATAGTGAAGCGGAAGCCGGTGTTCGTGAAGGTAGGCGACCTGAAACCTGGAACCAACGGCCATACCCTCGCCGTTAAGGTATTGACTGCGACGACGGTCTTAGACAAGAAATCACGCAATTCATCGTCATTCAGTAGCCGACCCGGCGCTGCTAATACTCGCATCGCTGAGTGCCTTATTGGTGATGAAAC...

Protein

Download Protein FASTA

160 aa · LXL04_010263|LXL04_010263|OH1004|PROTEIN

MATVNETTAVEIENQQPEQGARGIVKRKPVFVKVGDLKPGTNGHTLAVKVLTATTVLDKKSRNSSSFSSRPGAANTRIAECLIGDETGTILFTARNDQVDLMKAGNTVIIRNAKIDMFKGSMRLAVDKWGRIEVTEPASFTVKEDNNLSLVEYELVNVAE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010263`
TK1151 ID	TkA03G516210
OH-1004 ID	LXL04_010263
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010263

Location Chr02:143473518-143474272 (+)

Description Similar to At4g28440: Uncharacterized protein At4g28440

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g28440`	Uncharacterized protein At4g28440.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010263 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000724 double-strand break repair via homologous recombination Biological Process

GO:0010212 response to ionizing radiation Biological Process

GO:0005694 chromosome Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003729 mRNA binding Molecular Function

KEGG gene cross-reference

ath:AT4G28440

sso:SSO2364

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.733

Rank 1 · LXL04_010263 · OH-1004

Cytoplasm0.323

Rank 2 · LXL04_010263 · OH-1004

Mitochondrion0.057

Rank 3 · LXL04_010263 · OH-1004

Cell membrane0.052

Rank 4 · LXL04_010263 · OH-1004

Endoplasmic reticulum0.038

Rank 5 · LXL04_010263 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21473.5OB_Ssb-like37-134 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010263	`PF21473.5`	OB_Ssb-like	37	134	2.7e-45	153.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O49453`	Arabidopsis thaliana	Uncharacterized protein At4g28440	72.993%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card