TkA03G511310 | RubberDandelionOmics

Gene overview

TkA03G511310

Reference: TK1151 Chr: Chr03 Coordinates: 128216772-128217437 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

441 bp · TkA03G511310|TK1151|cDNA

ATGCACCACCGCCGGACCACCGCCGTACCACCGCCGGACCACCACATTCGTATTCGGACCATCAAACACCGAATAAGTCATGAAATCGACAGACATGAAGACGAAGACGATCCTACTGCGTTAAACCCTAGTTCTATCGCCGGAGACGGTCAGTCTAGGAATTCCGGAGGATCTAGGACCAGAACCTCTAGTTGTACCAAGGAAGAAGTCGATGCGATTCTGATACAATGTGGCAGGTTTAGTCGGAGCAATTCCGCGGG...

CDS

Download CDS FASTA

441 bp · TkA03G511310|TK1151|CDS

ATGCACCACCGCCGGACCACCGCCGTACCACCGCCGGACCACCACATTCGTATTCGGACCATCAAACACCGAATAAGTCATGAAATCGACAGACATGAAGACGAAGACGATCCTACTGCGTTAAACCCTAGTTCTATCGCCGGAGACGGTCAGTCTAGGAATTCCGGAGGATCTAGGACCAGAACCTCTAGTTGTACCAAGGAAGAAGTCGATGCGATTCTGATACAATGTGGCAGGTTTAGTCGGAGCAATTCCGCGGG...

Protein

Download Protein FASTA

146 aa · TkA03G511310|TK1151|PROTEIN

MHHRRTTAVPPPDHHIRIRTIKHRISHEIDRHEDEDDPTALNPSSIAGDGQSRNSGGSRTRTSSCTKEEVDAILIQCGRFSRSNSAGSQNPNRRRRYLRSNTSYDFDLDTSLKNDDGDDENDEAMNNHHRHREEVRVSSPSSTKNP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G511310`
TK1151 ID	TkA03G511310
OH-1004 ID	LXL04_010206
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	95.200
Protein coverage (%)	TK1151 84.932 / OH-1004 29.496 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G511310

Location Chr03:128216772-128217437 (-)

Description Similar to PBF: Dof zinc finger protein PBF

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g65710`	Uncharacterized protein At1g65710.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010206 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0048364 root development Biological Process

GO:0090057 root radial pattern formation Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G28310

ath:AT5G60200

ath:AT5G66940

dosa:Os02g0726300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.462

Rank 1 · TkA03G511310 · TK1151

Cytoplasm0.409

Rank 2 · TkA03G511310 · TK1151

Cell membrane0.316

Rank 3 · TkA03G511310 · TK1151

Endoplasmic reticulum0.046

Rank 4 · TkA03G511310 · TK1151

Mitochondrion0.023

Rank 5 · TkA03G511310 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30950At1g6571018-141 aa

PF14812PBP1_TM19-37 aa

PF14812PBP1_TM87-130 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G511310	`PF30950`	At1g65710	18	141	3.8e-26	92.8
TkA03G511310	`PF14812`	PBP1_TM	19	37	0.22	12.5
TkA03G511310	`PF14812`	PBP1_TM	87	130	0.22	12.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q5XVH5`	Arabidopsis thaliana	sp\|Q5XVH5\|Y1710_ARATH Uncharacterized protein At1g65710	40.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card