LXL04_010206 | RubberDandelionOmics

Gene overview

LXL04_010206

Reference: OH-1004 Chr: Chr02 Coordinates: 142118223-142120457 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1254 bp · LXL04_010206|LXL04_010206|OH1004|cDNA

atgaaaacgagaacaCGAGAAaaaacgtggagccttgatcaattcaagtggcatttttgtaattctgagaccaccggaccaccacctacacccaccggaccaccacctacacccaccggaccaccacctgcacccaccaccggaccaccgccggaccaccTTCGTATTCGGACCATCAAACACCGAATAAGTCATGAAATCGACAGACATGAAGACGAAGACGATCCTACTGCGTTAAACCCTAGTTCTATCGCCGGAGA...

CDS

Download CDS FASTA

1254 bp · LXL04_010206|LXL04_010206|OH1004|CDS

ATGAAAACGAGAACACGAGAAAAAACGTGGAGCCTTGATCAATTCAAGTGGCATTTTTGTAATTCTGAGACCACCGGACCACCACCTACACCCACCGGACCACCACCTACACCCACCGGACCACCACCTGCACCCACCACCGGACCACCGCCGGACCACCTTCGTATTCGGACCATCAAACACCGAATAAGTCATGAAATCGACAGACATGAAGACGAAGACGATCCTACTGCGTTAAACCCTAGTTCTATCGCCGGAGA...

Protein

Download Protein FASTA

417 aa · LXL04_010206|LXL04_010206|OH1004|PROTEIN

MKTRTREKTWSLDQFKWHFCNSETTGPPPTPTGPPPTPTGPPPAPTTGPPPDHLRIRTIKHRISHEIDRHEDEDDPTALNPSSIAGDGQSRNSGGSRTRTSSCTKEEVDAILIQCGRFSRSNSAGSQNPNRRRRYLRSNTSYDFDLDTSLKNDDGDDENDEAMNNHHRHREELSFIMSESEGLESPKPQSSGRQSKTLQPDPLKCPRCESTNTKFCYYNNYNKMQPRYVCKACKRHWTEGGILRSVPIGGGRKNKRLRRP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010206`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010206

Location Chr02:142118223-142120457 (-)

Description Similar to PBF: Dof zinc finger protein PBF

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g28310`	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence.	No verified direct reference in this release
`At5g66940`	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence.	No verified direct reference in this release
`At5g60200`	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity).	Mobile PEAR transcription factors integrate positional cues to prime cambial growth.2019 · DOI: 10.1038/s41586-018-0839-y

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0726300`	Transcription factor that may transactivate seed storage protein genes in developing seeds.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010206 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0048364 root development Biological Process

GO:0090057 root radial pattern formation Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G28310

ath:AT5G60200

ath:AT5G66940

dosa:Os02g0726300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.933

Rank 1 · LXL04_010206 · OH-1004

Cytoplasm0.146

Rank 2 · LXL04_010206 · OH-1004

Cell membrane0.040

Rank 3 · LXL04_010206 · OH-1004

Endoplasmic reticulum0.023

Rank 4 · LXL04_010206 · OH-1004

Mitochondrion0.012

Rank 5 · LXL04_010206 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30950.1At1g6571056-170 aa

PF02701.21Zn_ribbon_Dof202-255 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010206	`PF30950.1`	At1g65710	56	170	9.3e-25	88.2
LXL04_010206	`PF02701.21`	Zn_ribbon_Dof	202	255	1.8e-30	105.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FZA4`	Arabidopsis thaliana	Dof zinc finger protein DOF1.4	72.881%	Swiss-Prot	weak database homology
`Q9FGD6`	Arabidopsis thaliana	Dof zinc finger protein DOF5.8	43.609%	Swiss-Prot	weak database homology
`Q84TE9`	Arabidopsis thaliana	Dof zinc finger protein DOF5.3	44.037%	Swiss-Prot	weak database homology
`Q6Z345`	Oryza sativa subsp. japonica	Dof zinc finger protein 4	72.414%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card