TkA03G509670 | RubberDandelionOmics

Gene overview

TkA03G509670

Reference: TK1151 Chr: Chr03 Coordinates: 127804214-127804881 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

519 bp · TkA03G509670|TK1151|cDNA

ATGCAACGTTCAATATCCTCAACAAAGAATGTCTTCCGAAATATCATCAACTACCAAAACCCACCGTCTGCGGCGTTGGTCACCCGGCAGCAACCAACCTGTGACGTTTTCATCAACCACCGTGGGATCGACACCAAGAAGAGCGTTGCCGGCCTTTTGTATAATCATCTCACGAGGTTAAGATTGCAACCATTCTTGGACAGCAAGAATATGAAACCCGGTGATAGATTATTCGATAAAATTGAGACTGCAATCAGCGG...

CDS

Download CDS FASTA

519 bp · TkA03G509670|TK1151|CDS

ATGCAACGTTCAATATCCTCAACAAAGAATGTCTTCCGAAATATCATCAACTACCAAAACCCACCGTCTGCGGCGTTGGTCACCCGGCAGCAACCAACCTGTGACGTTTTCATCAACCACCGTGGGATCGACACCAAGAAGAGCGTTGCCGGCCTTTTGTATAATCATCTCACGAGGTTAAGATTGCAACCATTCTTGGACAGCAAGAATATGAAACCCGGTGATAGATTATTCGATAAAATTGAGACTGCAATCAGCGG...

Protein

Download Protein FASTA

172 aa · TkA03G509670|TK1151|PROTEIN

MQRSISSTKNVFRNIINYQNPPSAALVTRQQPTCDVFINHRGIDTKKSVAGLLYNHLTRLRLQPFLDSKNMKPGDRLFDKIETAISGCKVAVAVFSPRYCQSHYCLHELARIMELKKKVIPVFCDVKPSELKVKDNWRYPEHEIDRFRSALEEAKYTVGLTFDSSNGDWPGF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G509670`
TK1151 ID	TkA03G509670
OH-1004 ID	LXL04_010196
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	79.100
Protein coverage (%)	TK1151 100.000 / OH-1004 88.205 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G509670

Location Chr03:127804214-127804881 (-)

Description Similar to BRADI_1g24377v3: TIR-only protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g17880`	TIR-NB-LRR receptor-like protein that functions in photomorphogenic development.	A constitutive shade-avoidance mutant implicates TIR-NBS-LRR proteins in Arabidopsis photomorphogenic development.2006 · DOI: 10.1105/tpc.105.038810
`At5g44920`	Could play a role in nuclear morphology, specifically nuclear size.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010196 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0007165 signal transduction Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0010114 response to red light Biological Process

GO:0019677 NAD+ catabolic process Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0043068 positive regulation of programmed cell death Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009506 plasmodesma Cellular Component

KEGG gene cross-reference

ath:AT1G72930

ath:AT5G17880

bdi:100831488

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.368

Rank 1 · TkA03G509670 · TK1151

Cell membrane0.347

Rank 2 · TkA03G509670 · TK1151

Nucleus0.265

Rank 3 · TkA03G509670 · TK1151

Endoplasmic reticulum0.079

Rank 4 · TkA03G509670 · TK1151

Plastid0.076

Rank 5 · TkA03G509670 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01582TIR35-131 aa

PF13676TIR_236-131 aa

PF10137CAP12-PCTIR_TIR36-97 aa

PF13676TIR_2144-160 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G509670	`PF01582`	TIR	35	131	1.9e-19	70.9
TkA03G509670	`PF13676`	TIR_2	36	131	3.3e-18	67.0
TkA03G509670	`PF10137`	CAP12-PCTIR_TIR	36	97	0.015	16.0
TkA03G509670	`PF13676`	TIR_2	144	160	3.3e-18	67.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4KIF3`	Arabidopsis thaliana	sp\|F4KIF3\|CSA1_ARATH Disease resistance-like protein CSA1	31.400%	Swiss-Prot	Medium
`Q0WSX8`	Arabidopsis thaliana	sp\|Q0WSX8\|TIK_ARATH TIR domain-containing protein	38.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card