TkA03G494910 | RubberDandelionOmics

Gene overview

TkA03G494910

Reference: TK1151 Chr: Chr03 Coordinates: 124197351-124202272 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3172 bp · TkA03G494910|TK1151|cDNA

TTAACCGACCCGCAATTGTGCATTTTTAGGTGAAGATTCCATCAAATTTAACAAGTTTTGACGTGCGCAATTCATCGGATTTAGCCCGAAACCTGACCTCTTTTTGACCCGAAATACACGAAAGCTTCTTCCTTTTCTTCTCTATCCAAATTTCTAGGCTATCGACGGCAACCCTCTTGTGTATCTCTCATCGGAGACGAAACGGGATCTAGGGTTCAACCTTCAGCTTCTCACCGTACAACTGAGGTCTCTTAAACCGA...

CDS

Download CDS FASTA

2259 bp · TkA03G494910|TK1151|CDS

ATGACTTATTCATCTGATGAAGATGAGCCCTTGGTTTTCAAAAGGAGCTCAAATTCTGTCAGATTGAAACATTCCACTCAACAGAAGCCACCTGTCACTGCCCCTAAACCTGTTCCCAAACCTGCTCCTAAACCAAAGAGCGACTCAGAGGATTCTGAAGATGACAAACCATTAATCTCACGTATTTCATCTGTACCCATTAAGCCAAACTCCAATCACTCAAAAACAACCCCTAGTTCATCACAACAACCCAGACCACA...

Protein

Download Protein FASTA

752 aa · TkA03G494910|TK1151|PROTEIN

MTYSSDEDEPLVFKRSSNSVRLKHSTQQKPPVTAPKPVPKPAPKPKSDSEDSEDDKPLISRISSVPIKPNSNHSKTTPSSSQQPRPQVKIEDSNDVKVKPLPSKFTSRPSVGQSIKKHDDSQDNKPLPSRVNQNGSTSNNNNNNQIRKPNIGLNKRPPNEERSSSQQPVKKPKLSGSLSPTPVIQKTMKPEVESDDENDHVPISQRIKNQSPSSSKSKSSSVKKVIKVNSSSTTFKKSKKVEKNSKFAKPSKVPPGSGEG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G494910`
TK1151 ID	TkA03G494910
OH-1004 ID	LXL04_034710
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	67.300
Protein coverage (%)	TK1151 99.734 / OH-1004 92.875 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G494910

Location Chr03:124197351-124202272 (-)

Description Similar to TOP1A: DNA topoisomerase 1 alpha

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g55310`	Releases the supercoiling and torsional tension of DNA introduced during the DNA replication and transcription by transiently cleaving and rejoining one strand of the DNA duplex.	Disruption of a DNA topoisomerase I gene affects morphogenesis in Arabidopsis.2002 · DOI: 10.1105/tpc.001925
`At5g55300`	Releases the supercoiling and torsional tension of DNA introduced during the DNA replication and transcription by transiently cleaving and rejoining one strand of the DNA duplex.	Disruption of a DNA topoisomerase I gene affects morphogenesis in Arabidopsis.2002 · DOI: 10.1105/tpc.001925 MGOUN1 encodes an Arabidopsis type IB DNA topoisomerase required in stem cell regulation and to maintain developmentally regulated gene silencing.2010 · DOI: 10.1105/tpc.109.068296

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034710 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006260 DNA replication Biological Process

GO:0006265 DNA topological change Biological Process

GO:0006338 chromatin remodeling Biological Process

GO:0007059 chromosome segregation Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009933 meristem structural organization Biological Process

GO:0009965 leaf morphogenesis Biological Process

GO:0010016 shoot system morphogenesis Biological Process

GO:0010075 regulation of meristem growth Biological Process

GO:0019827 stem cell population maintenance Biological Process

GO:0030261 chromosome condensation Biological Process

KEGG gene cross-reference

ath:AT5G55300

ath:AT5G55310

ddi:DDB_G0283205

dme:Dmel_CG6146

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.845

Rank 1 · TkA03G494910 · TK1151

Cytoplasm0.195

Rank 2 · TkA03G494910 · TK1151

Mitochondrion0.038

Rank 3 · TkA03G494910 · TK1151

Cell membrane0.035

Rank 4 · TkA03G494910 · TK1151

Endoplasmic reticulum0.026

Rank 5 · TkA03G494910 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02919Topoisom_I_N261-473 aa

PF23083FF_RHG35_4th332-354 aa

PF29308YEL043W_helical354-377 aa

PF23083FF_RHG35_4th440-448 aa

PF01028Topoisom_I476-702 aa

PF04012PspA_IM30658-709 aa

PF29308YEL043W_helical659-748 aa

PF02919Topoisom_I_N717-736 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G494910	`PF02919`	Topoisom_I_N	261	473	1.3e-94	316.4
TkA03G494910	`PF23083`	FF_RHG35_4th	332	354	0.052	14.6
TkA03G494910	`PF29308`	YEL043W_helical	354	377	0.81	10.5
TkA03G494910	`PF23083`	FF_RHG35_4th	440	448	0.052	14.6
TkA03G494910	`PF01028`	Topoisom_I	476	702	1.6e-95	319.5
TkA03G494910	`PF04012`	PspA_IM30	658	709	0.77	10.0
TkA03G494910	`PF29308`	YEL043W_helical	659	748	0.81	10.5
TkA03G494910	`PF02919`	Topoisom_I_N	717	736	1.3e-94	316.4
TkA03G494910	`PF04012`	PspA_IM30	727	749	0.77	10.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FJ79`	Arabidopsis thaliana	sp\|Q9FJ79\|TOP1B_ARATH DNA topoisomerase 1 beta	60.900%	Swiss-Prot	High
`P30181`	Arabidopsis thaliana	sp\|P30181\|TOP1A_ARATH DNA topoisomerase 1 alpha	58.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card