TkA03G481880 | RubberDandelionOmics

Gene overview

TkA03G481880

Reference: TK1151 Chr: Chr03 Coordinates: 120512588-120514637 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1026 bp · TkA03G481880|TK1151|cDNA

CGCCTATTTACCCCAAATCCAATTTCCTAATTTTTTGGCAGGATTTTCAAATTTTCTTCATTTATGGTAAATATTCAATAGTTACTGTATTTTATCCCAAATCCCGATCGCTATCTTCATTATTTTTACATTATCGTTCGTATTCATCTTGCTTTTCCATCAAGCTTCTTCTCCCCTATCCCTCTCTCTCATTCGACACCATCATATGTATACTCCACTTTCTCCGTCGTTGCTCTTCCTCATCCCCGTTTACAACCACA...

CDS

Download CDS FASTA

681 bp · TkA03G481880|TK1151|CDS

ATGTATACTCCACTTTCTCCGTCGTTGCTCTTCCTCATCCCCGTTTACAACCACATTACTCACAGGGGTGGCACTAGGATGGTGCCAGGGACTCCGGTCCTATCCCTTAGATCGATTCAAGAACCATTTTTTTGGATGTTGCTGATTCATGTAGAAATCTCCATGGAGGGATGTTTAAGGGTGCTGCTACAGGTGGGCTTTGACAATTTCACCATTAGTCTAGGGTGCTGCCTATGGAGACTTGGGGACTTATGCCAAGG...

Protein

Download Protein FASTA

226 aa · TkA03G481880|TK1151|PROTEIN

MYTPLSPSLLFLIPVYNHITHRGGTRMVPGTPVLSLRSIQEPFFWMLLIHVEISMEGCLRVLLQVGFDNFTISLGCCLWRLGDLCQGTPFAGGYYYGKIKFPADYPFKHPEITMTTPNGRFITQKEICLSTSDFHPESWNPMYIFQNCDGKVLYSPTFRKLFPEYVQKYEQQWVSEQAAVVEEVQGGGSGRPQEDNNNNNDNNNKREEKKEVKRVELRKEELKWQK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G481880`
TK1151 ID	TkA03G481880
OH-1004 ID	LXL04_002516
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	77.400
Protein coverage (%)	TK1151 68.142 / OH-1004 86.364 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G481880

Location Chr03:120512588-120514637 (-)

Description Similar to UBC33: Probable ubiquitin-conjugating enzyme E2 33

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g17280`	Accepts the ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins.	No verified direct reference in this release
`At5g50430`	Accepts the ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002516 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000209 protein polyubiquitination Biological Process

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0006986 response to unfolded protein Biological Process

GO:0036503 ERAD pathway Biological Process

GO:0042631 cellular response to water deprivation Biological Process

GO:0085020 protein K6-linked ubiquitination Biological Process

GO:0180027 inner nuclear membrane-associated protein degradation pathway Biological Process

GO:1902457 negative regulation of stomatal opening Biological Process

GO:1903955 positive regulation of protein targeting to mitochondrion Biological Process

GO:0000151 ubiquitin ligase complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

KEGG gene cross-reference

ath:AT1G17280

ath:AT5G50430

ddi:DDB_G0286511

hsa:118424

spo:2541642

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.490

Rank 1 · TkA03G481880 · TK1151

Nucleus0.433

Rank 2 · TkA03G481880 · TK1151

Mitochondrion0.113

Rank 3 · TkA03G481880 · TK1151

Endoplasmic reticulum0.086

Rank 4 · TkA03G481880 · TK1151

Cell membrane0.067

Rank 5 · TkA03G481880 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00179UQ_con86-144 aa

PF05773RWD98-118 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G481880	`PF00179`	UQ_con	86	144	1.2e-05	25.7
TkA03G481880	`PF05773`	RWD	98	118	0.18	12.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SHI7`	Arabidopsis thaliana	sp\|Q9SHI7\|UBC34_ARATH Ubiquitin-conjugating enzyme E2 34	52.000%	Swiss-Prot	Low
`Q9FK29`	Arabidopsis thaliana	sp\|Q9FK29\|UBC33_ARATH Probable ubiquitin-conjugating enzyme E2 33	52.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card