Gene Card
Gene overview
cDNA / CDS / Protein Sequences
663 bp · LXL04_002516|LXL04_002516|OH1004|cDNA
ATGTATATTCCACTTTCTCCGTCGTTGCTCTTCCTCATCCCCGTTTACAACCACATTACTCACAGGGGTGGGACTAGGATGGTGCCAGGGACTCCGGTCCTATCCCTTAGATCGATTCAAGAACCATTTTTTTGGATGTTGCTGATTCATGTAGAAATCTCCATGGATAGATGTTTAAGGGTGCTGCTACAGGTGGGCTTTGACAATTTCACCATTAGTCTAGGGTGCTGCCTATGGAGACTTGGGGACTTATGGTTTTC...
663 bp · LXL04_002516|LXL04_002516|OH1004|CDS
ATGTATATTCCACTTTCTCCGTCGTTGCTCTTCCTCATCCCCGTTTACAACCACATTACTCACAGGGGTGGGACTAGGATGGTGCCAGGGACTCCGGTCCTATCCCTTAGATCGATTCAAGAACCATTTTTTTGGATGTTGCTGATTCATGTAGAAATCTCCATGGATAGATGTTTAAGGGTGCTGCTACAGGTGGGCTTTGACAATTTCACCATTAGTCTAGGGTGCTGCCTATGGAGACTTGGGGACTTATGGTTTTC...
Protein
Download Protein FASTA220 aa · LXL04_002516|LXL04_002516|OH1004|PROTEIN
MYIPLSPSLLFLIPVYNHITHRGGTRMVPGTPVLSLRSIQEPFFWMLLIHVEISMDRCLRVLLQVGFDNFTISLGCCLWRLGDLWFSKFVVKSDDWYPNCFSKCLGENLQLKLEFDVSEGSQGTPFAGGYYYGKIKFLADYPFKHPEITMTTPDGQFITQKEICLSTSDFHPESWNPMYIFQNCDGKVLYRNMNNSGYQNRRQWWKRCRMVELKWKATGG
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_002516 |
|---|---|
| TK1151 ID | TkA03G481880 |
| OH-1004 ID | LXL04_002516 |
| Relationship / confidence | Multi Candidate From Tk1151 / Complex relationship |
| Protein identity (%) | 77.400 |
| Protein coverage (%) | TK1151 68.142 / OH-1004 86.364Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_002516 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:50621598-50623215 (-) | |||||||||
| Description | Similar to UBC33: Probable ubiquitin-conjugating enzyme E2 33 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000209 protein polyubiquitination Biological Process GO:0006511 ubiquitin-dependent protein catabolic process Biological Process GO:0006986 response to unfolded protein Biological Process GO:0036503 ERAD pathway Biological Process GO:0042631 cellular response to water deprivation Biological Process GO:0085020 protein K6-linked ubiquitination Biological Process GO:0180027 inner nuclear membrane-associated protein degradation pathway Biological Process GO:1902457 negative regulation of stomatal opening Biological Process GO:1903955 positive regulation of protein targeting to mitochondrion Biological Process GO:0000151 ubiquitin ligase complex Cellular Component GO:0005634 nucleus Cellular Component GO:0005783 endoplasmic reticulum Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT1G17280 ath:AT5G50430 ddi:DDB_G0286511 hsa:118424 spo:2541642 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.