RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA03G479920
Reference: TK1151 Chr: Chr03 Coordinates: 120015739-120021137 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2601 bp · TkA03G479920|TK1151|cDNA

CTTCATTATACCTGTCAGTGATCTCCGTTGTCATTTTCTCTCTCCAAATATACATATGAACTAGTTGTACCTATCTATACTCAGTCACGTAGCAGAGGTGCTGACCAGAGGACTTAGATCTTCTTCCTGATGGATGCGGCTTTGCTTGAGGGAGAAAGTAGTAGTCGATGGGGTGTTGCAGGAGGCCGGAGAGAATATAAACGACGGTCGGATGCCATCGCTTACGGATCGCCTTATCAGAAGGCGGCTGCTCTTGTCGA...

CDS

Download CDS FASTA

2220 bp · TkA03G479920|TK1151|CDS

ATGGATGCGGCTTTGCTTGAGGGAGAAAGTAGTAGTCGATGGGGTGTTGCAGGAGGCCGGAGAGAATATAAACGACGGTCGGATGCCATCGCTTACGGATCGCCTTATCAGAAGGCGGCTGCTCTTGTCGATCTCGCTGAAGATGGAGCTGGTCTACCAGAGGAAATCCTTGACTTACCAAACATTGAATCTGCTGCAAAGTTCTACTTCATCTTCATTCGCTTTGACATCATATGGACCCTTAACTATTTTGCACTCAT...

Protein

Download Protein FASTA

739 aa · TkA03G479920|TK1151|PROTEIN

MDAALLEGESSSRWGVAGGRREYKRRSDAIAYGSPYQKAAALVDLAEDGAGLPEEILDLPNIESAAKFYFIFIRFDIIWTLNYFALIALNFFEKPLWCTSVSEVTCSDREYYYLGELPYLTNAESLAFEGVTLIILVVHTLFPILYEGGQLYWKSHVNKLKIISLLILVADLIVDIIYLSPVAIYSLPLRIAPYIRVVFFILNIRDLRDSMVVLAGMLSTYLNVLALFFLFLVFSSWLAYVIFEDTQQGTAIFMSYPATL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA03G479920
TK1151 IDTkA03G479920
OH-1004 IDLXL04_009882
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)100.000
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA03G479920
LocationChr03:120015739-120021137 (-)
DescriptionSimilar to TPC1A: Two pore calcium channel protein 1A
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At4g03560 May act as a voltage-gated inward-rectifying Ca²⁺ channel in the vacuolar membrane.
Aluminum as a specific inhibitor of plant TPC1 Ca2+ channels.2004 · DOI: 10.1016/j.bbrc.2004.09.015
The vacuolar Ca2+-activated channel TPC1 regulates germination and stomatal movement.2005 · DOI: 10.1038/nature03381

Rice

Reference gene IDPossible functionPapers / DOI
Os01g0678500 May act as a voltage-gated Ca²⁺ channel in calcium signaling and defense responses.
Functional analysis of a rice putative voltage-dependent Ca2+ channel, OsTPC1, expressed in yeast cells lacking its homologous gene CCH1.2004 · DOI: 10.1093/pcp/pch053
Identification of a putative voltage-gated Ca2+ -permeable channel (OsTPC1) involved in Ca2+ influx and regulation of growth and development in rice.2004 · DOI: 10.1093/pcp/pch082
Identification of a putative voltage-gated Ca2+ channel as a key regulator of elicitor-induced hypersensitive cell death and mitogen-activated protein kinase activation in rice.2005 · DOI: 10.1111/j.1365-313x.2005.02415.x
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_009882 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006816 calcium ion transport Biological Process
GO:0006952 defense response Biological Process
GO:0009845 seed germination Biological Process
GO:0010119 regulation of stomatal movement Biological Process
GO:0019722 calcium-mediated signaling Biological Process
GO:0080141 regulation of jasmonic acid biosynthetic process Biological Process
GO:0000325 plant-type vacuole Cellular Component
GO:0005773 vacuole Cellular Component
GO:0005774 vacuolar membrane Cellular Component
GO:0005794 Golgi apparatus Cellular Component
GO:0005829 cytosol Cellular Component
GO:0005886 plasma membrane Cellular Component
KEGG gene cross-reference
ath:AT4G03560
dosa:Os01g0678500
nta:107770546
nta:107819477
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.334
Rank 1 · TkA03G479920 · TK1151
Cell membrane0.268
Rank 2 · TkA03G479920 · TK1151
Endoplasmic reticulum0.166
Rank 3 · TkA03G479920 · TK1151
Cytoplasm0.164
Rank 4 · TkA03G479920 · TK1151
Golgi apparatus0.161
Rank 5 · TkA03G479920 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16118DUF483470-91 aa
PF00520Ion_trans128-314 aa
PF16118DUF4834289-309 aa
PF13499EF-hand_7332-396 aa
PF13405EF-hand_6332-359 aa
PF00036EF-hand_1332-357 aa
PF13499EF-hand_7371-416 aa
PF00036EF-hand_1372-398 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA03G479920PF16118DUF483470913.59.4
TkA03G479920PF00520Ion_trans1283141.4e-55188.9
TkA03G479920PF16118DUF48342893093.59.4
TkA03G479920PF13499EF-hand_73323962.9e-0525.0
TkA03G479920PF13405EF-hand_63323590.002618.1
TkA03G479920PF00036EF-hand_13323570.01915.2
TkA03G479920PF13499EF-hand_73714162.9e-0525.0
TkA03G479920PF00036EF-hand_13723980.01915.2
TkA03G479920PF13405EF-hand_63733980.002618.1
TkA03G479920PF13179DUF40064304690.004117.5
TkA03G479920PF00520Ion_trans4356791.4e-55188.9
TkA03G479920PF16118DUF48344404533.59.4
TkA03G479920PF16118DUF48346527093.59.4
TkA03G479920PF13179DUF40066606770.004117.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q94KI8Arabidopsis thalianasp|Q94KI8|TPC1_ARATH Two pore calcium channel protein 164.700%Swiss-ProtHigh
Q5QM84Oryza sativa subsp. japonicasp|Q5QM84|TPC1_ORYSJ Two pore calcium channel protein 162.000%Swiss-ProtHigh

JBrowse

View in Genome Browser