TkA03G469750 | RubberDandelionOmics

Gene overview

TkA03G469750

Reference: TK1151 Chr: Chr03 Coordinates: 117394225-117395633 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1142 bp · TkA03G469750|TK1151|cDNA

GTTCTTCAAACCTATTATCTAGATAGAATTAATTCTAGAAGAACTGGTTGCACAAAAATGGTGAGGGCACCTTATTTCGACAAAGATGGAGTAAAAAAAGGAGCATGGAGCGAATCTGAAGATCAACAGTTGAGATCATATATCGAGAAAAACGGTTATTCAAACTGGCGCAAGCTCCCCAAGTTAGCCGGGTTATCAAGATGTGGAAAGAGTTGCCGGCTTAGATGGATGAATTATCTTGATCCAACTATAAATCGAGG...

CDS

Download CDS FASTA

804 bp · TkA03G469750|TK1151|CDS

ATGGTGAGGGCACCTTATTTCGACAAAGATGGAGTAAAAAAAGGAGCATGGAGCGAATCTGAAGATCAACAGTTGAGATCATATATCGAGAAAAACGGTTATTCAAACTGGCGCAAGCTCCCCAAGTTAGCCGGGTTATCAAGATGTGGAAAGAGTTGCCGGCTTAGATGGATGAATTATCTTGATCCAACTATAAATCGAGGAAATTACACCGACAAAGAAGAAGCTCTAATCATCAGCTTACACCGCACTCTTGGCAA...

Protein

Download Protein FASTA

267 aa · TkA03G469750|TK1151|PROTEIN

MVRAPYFDKDGVKKGAWSESEDQQLRSYIEKNGYSNWRKLPKLAGLSRCGKSCRLRWMNYLDPTINRGNYTDKEEALIISLHRTLGNKWSKIAAELPGRSDNDVKNHWHTHLRKRVITPNSPIRVSNSGHELVPSPKCSTKEKCVLEGSDLKDRDEVELLITVLSSDQSSYDANNEQQSPSSWSSSLDQVGWNSYSPEVVSNEEPVNDYWSIMGDDIFMEHMDLMVGNYDGSLTSGHDTIMIGDCLWQSVQFCGNDTCGD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G469750`
TK1151 ID	TkA03G469750
OH-1004 ID	LXL04_025453
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	49.500
Protein coverage (%)	TK1151 79.775 / OH-1004 92.760 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G469750

Location Chr03:117394225-117395633 (-)

Description Similar to MYB4: Transcription factor MYB4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g17785`	Transcription factor MYB39.	No verified direct reference in this release
`At3g12820`	Involved in metal ions homeostasis, including iron ions (Fe) acquisition, via the regulation of NAS4 and NAS2 genes expression.	No verified direct reference in this release
`At1g56160`	Involved in metal ions homeostasis, including iron ions (Fe) acquisition, via the regulation of NAS4 and NAS2 genes expression.	Expression differences for genes involved in lignin, glutathione and sulphate metabolism in response to cadmium in Arabidopsis thaliana and the related Zn/Cd-hyperaccumulator Thlaspi caerulescens.2008 · DOI: 10.1111/j.1365-3040.2007.01764.x MYB72 is required in early signaling steps of rhizobacteria-induced systemic resistance in Arabidopsis.2008 · DOI: 10.1104/pp.107.113829 MYB72, a node of convergence in induced systemic resistance triggered by a fungal and a bacterial beneficial microbe.2009 · DOI: 10.1111/j.1438-8677.2008.00162.x β-Glucosidase BGLU42 is a MYB72-dependent key regulator of rhizobacteria-induced systemic resistance and modulates iron deficiency responses in Arabidopsis roots.2014 · DOI: 10.1111/nph.12980
`At3g23250`	Transcription factor involved in cold-regulation of CBF genes and in the development of freezing tolerance.	A R2R3 type MYB transcription factor is involved in the cold regulation of CBF genes and in acquired freezing tolerance.2006 · DOI: 10.1074/jbc.m605895200 Transgenic expression of MYB15 confers enhanced sensitivity to abscisic acid and improved drought tolerance in Arabidopsis thaliana.2009 · DOI: 10.1016/s1673-8527(09)60003-5
`At2g31180`	Transcription activator that regulates freezing tolerance by affecting expression of CBF genes.	AtMYB14 Regulates Cold Tolerance in Arabidopsis. 2013 · DOI: 10.1007/s11105-012-0481-z

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025453 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009409 response to cold Biological Process

GO:0009411 response to UV Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009809 lignin biosynthetic process Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0050826 response to freezing Biological Process

GO:2000652 regulation of secondary cell wall biogenesis Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003677 DNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G79180

ath:AT2G31180

ath:AT3G23250

dosa:Os02g0624300

dosa:Os04g0517100

osa:4330027

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.953

Rank 1 · TkA03G469750 · TK1151

Cytoplasm0.128

Rank 2 · TkA03G469750 · TK1151

Cell membrane0.025

Rank 3 · TkA03G469750 · TK1151

Endoplasmic reticulum0.013

Rank 4 · TkA03G469750 · TK1151

Plastid0.013

Rank 5 · TkA03G469750 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00249Myb_DNA-binding14-61 aa

PF13921Myb_DNA-bind_617-76 aa

PF00249Myb_DNA-binding67-112 aa

PF13921Myb_DNA-bind_671-114 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G469750	`PF00249`	Myb_DNA-binding	14	61	1.4e-34	118.6
TkA03G469750	`PF13921`	Myb_DNA-bind_6	17	76	2.9e-21	76.1
TkA03G469750	`PF00249`	Myb_DNA-binding	67	112	1.4e-34	118.6
TkA03G469750	`PF13921`	Myb_DNA-bind_6	71	114	2.9e-21	76.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GWP0`	Arabidopsis thaliana	sp\|Q8GWP0\|MYB39_ARATH Transcription factor MYB39	63.600%	Swiss-Prot	Low
`Q9LTV4`	Arabidopsis thaliana	sp\|Q9LTV4\|MYB10_ARATH Transcription factor MYB10	63.500%	Swiss-Prot	Low
`Q9SGU3`	Arabidopsis thaliana	sp\|Q9SGU3\|MYB72_ARATH Transcription factor MYB72	60.500%	Swiss-Prot	Low
`Q9LTC4`	Arabidopsis thaliana	sp\|Q9LTC4\|MYB15_ARATH Transcription factor MYB15	65.500%	Swiss-Prot	Low
`Q9SJX8`	Arabidopsis thaliana	sp\|Q9SJX8\|MYB14_ARATH Transcription factor MYB14	64.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card