TkA03G467200 | RubberDandelionOmics

Gene overview

TkA03G467200

Reference: TK1151 Chr: Chr03 Coordinates: 116656418-116658370 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1428 bp · TkA03G467200|TK1151|cDNA

ATGGTTCGGGACATAGGGTATCTCACTGAGACTCCTCTATTCTACCAATACTGCAAACCCAATATTTGTTTAGACTATAGGTTAATGTCGTTAGGCAATGACCAGGATGTGCTCACAATGACGGCATATATCCCAAGACACCGAGAAATTTTAGTGTATATTGAAACTGGGGAGACAACAACCTATATTTACGACAAGTCTCTTTCAAAAGTTATTATAGAGGAGTTGGTTGAACCAGTGCCTCTTGTTGTGTCACCAGA...

CDS

Download CDS FASTA

1428 bp · TkA03G467200|TK1151|CDS

ATGGTTCGGGACATAGGGTATCTCACTGAGACTCCTCTATTCTACCAATACTGCAAACCCAATATTTGTTTAGACTATAGGTTAATGTCGTTAGGCAATGACCAGGATGTGCTCACAATGACGGCATATATCCCAAGACACCGAGAAATTTTAGTGTATATTGAAACTGGGGAGACAACAACCTATATTTACGACAAGTCTCTTTCAAAAGTTATTATAGAGGAGTTGGTTGAACCAGTGCCTCTTGTTGTGTCACCAGA...

Protein

Download Protein FASTA

475 aa · TkA03G467200|TK1151|PROTEIN

MVRDIGYLTETPLFYQYCKPNICLDYRLMSLGNDQDVLTMTAYIPRHREILVYIETGETTTYIYDKSLSKVIIEELVEPVPLVVSPEMDKGIKYQLSQVINPQVKALVGTEPEKGDEVNVVTEPLVNEVVTEAFVDEVVIEDVDPDIGAGDEQGLGHQVENDMFAELEDMIDHDYSIVGDINGQYNVIQASEDEITVLHDNSEGAKNLESFDNVDDELRPVDLDGGQFAGFAEDERKRMLMELNRPSSCSEGVVHAKTFI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G467200`
TK1151 ID	TkA03G467200
OH-1004 ID	LXL04_035285
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	59.600
Protein coverage (%)	TK1151 99.368 / OH-1004 50.999 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G467200`
Location	Chr03:116656418-116658370 (+)
Description	Similar to BB: E3 ubiquitin-protein ligase BIG BROTHER
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_035285` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0008285 negative regulation of cell population proliferation Biological Process GO:0009845 seed germination Biological Process GO:0009908 flower development Biological Process GO:0010218 response to far red light Biological Process GO:0010228 vegetative to reproductive phase transition of meristem Biological Process GO:0016567 protein ubiquitination Biological Process GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process GO:0046621 negative regulation of organ growth Biological Process GO:0048437 floral organ development Biological Process GO:0051865 protein autoubiquitination Biological Process GO:1900057 positive regulation of leaf senescence Biological Process GO:0005634 nucleus Cellular Component
KEGG gene cross-reference	ath:AT3G19910 ath:AT3G63530 ath:AT4G34040 ath:AT5G42940 dosa:Os04g0648800 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.942

Rank 1 · TkA03G467200 · TK1151

Cytoplasm0.138

Rank 2 · TkA03G467200 · TK1151

Cell membrane0.018

Rank 3 · TkA03G467200 · TK1151

Mitochondrion0.017

Rank 4 · TkA03G467200 · TK1151

Endoplasmic reticulum0.011

Rank 5 · TkA03G467200 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26130PB1-like1-55 aa

PF03108DBD_Tnp_Mut261-302 aa

PF08731AFT265-357 aa

PF03108DBD_Tnp_Mut332-348 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G467200	`PF26130`	PB1-like	1	55	0.16	12.9
TkA03G467200	`PF03108`	DBD_Tnp_Mut	261	302	1.8e-05	25.0
TkA03G467200	`PF08731`	AFT	265	357	0.00092	20.2
TkA03G467200	`PF03108`	DBD_Tnp_Mut	332	348	1.8e-05	25.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card