RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_035285
Reference: OH-1004 Chr: Chr08 Coordinates: 19239903-19247175 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3937 bp · LXL04_035285|LXL04_035285|OH1004|cDNA

TCGGGTCACGTGCATCGCATACGAGGGTAGAAGCGTCAATTCAGGTATAGCCTATTATTTATCGCGGGAATTGAGAGAGCCCCTGTTACGTCTGCTTTTTCTCATCATTCCCTGGTCGAAGCTTCCATTTCTTCTTACTCTTACTGTTAATCGATAACCCTTTTGAAGAGATTACAGGTGATTGTTGAAAGTAACCATGGTGCTAACTATCTGGGAGCTTCGTAAAGGGTTAAAACATCCTGACCTGGACAAGGCATACG...

CDS

Download CDS FASTA

3756 bp · LXL04_035285|LXL04_035285|OH1004|CDS

TTGTTGAAAGTAACCATGGTGCTAACTATCTGGGAGCTTCGTAAAGGGTTAAAACATCCTGACCTGGACAAGGCATACGAAGCCACAGATAACTATTTCACGTTGAAGCTACACTACGGAGGCGTCTTCAACAAGGTCCCGGGTCGTAAATACAAAAACGGTAATGTGGCTTACTTCGATTTTGTAGATATAGACATTTTCTCAGTGCATGATATCAACGAGATGGTCCGGGACATAGGGTATCTCACTGAGACTCCTCT...

Protein

Download Protein FASTA

1251 aa · LXL04_035285|LXL04_035285|OH1004|PROTEIN

MLKVTMVLTIWELRKGLKHPDLDKAYEATDNYFTLKLHYGGVFNKVPGRKYKNGNVAYFDFVDIDIFSVHDINEMVRDIGYLTETPLFYQYCKPNICLDYGLMRLGNDQDVLTMTAYIPRHREISVYIETGETTTFIYDKSPSKVIIEELDEPTQVLPEMDPDIKWSRGGKRSCSKKLKLDDHLVESSQPQSQVINDGVWDPTRKDLVSFVSTQVRQVSQVINPQVEALVEVVVEGVGREPEKGDEPEKGDEVNMVNEPV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_035285
Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_035285
LocationChr08:19239903-19247175 (+)
DescriptionSimilar to BB: E3 ubiquitin-protein ligase BIG BROTHER
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g63530 E3 ubiquitin-protein ligase that limits organ size, and possibly seed size, in a dose-dependent manner.
Forever Young: The Role of Ubiquitin Receptor DA1 and E3 Ligase BIG BROTHER in Controlling Leaf Growth and Development.2017 · DOI: 10.1104/pp.16.01410
At3g19910 E3 ubiquitin-ligase probably involved in organ size regulation. No verified direct reference in this release
At5g42940 Probable E3 ubiquitin-protein ligase that may possess E3 ubiquitin ligase activity in vitro. No verified direct reference in this release
At4g34040 E3 ubiquitin-protein ligase that functions as a regulator of MED25 stability by targeting MED25 for degradation in a RING-H2- dependent way.
Proteasome-mediated turnover of Arabidopsis MED25 is coupled to the activation of FLOWERING LOCUS T transcription.2012 · DOI: 10.1104/pp.112.205500

Rice

Reference gene IDPossible functionPapers / DOI
Os04g0648800 Probable E3 ubiquitin-protein ligase that functions downstream of HAL3 and is required for HAL3-regulated plant growth. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_035285 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0008285 negative regulation of cell population proliferation Biological Process
GO:0009845 seed germination Biological Process
GO:0009908 flower development Biological Process
GO:0010218 response to far red light Biological Process
GO:0010228 vegetative to reproductive phase transition of meristem Biological Process
GO:0016567 protein ubiquitination Biological Process
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process
GO:0046621 negative regulation of organ growth Biological Process
GO:0048437 floral organ development Biological Process
GO:0051865 protein autoubiquitination Biological Process
GO:1900057 positive regulation of leaf senescence Biological Process
GO:0005634 nucleus Cellular Component
KEGG gene cross-reference
ath:AT3G19910
ath:AT3G63530
ath:AT4G34040
ath:AT5G42940
dosa:Os04g0648800
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.945
Rank 1 · LXL04_035285 · OH-1004
Cytoplasm0.162
Rank 2 · LXL04_035285 · OH-1004
Cell membrane0.020
Rank 3 · LXL04_035285 · OH-1004
Mitochondrion0.018
Rank 4 · LXL04_035285 · OH-1004
Endoplasmic reticulum0.012
Rank 5 · LXL04_035285 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26130.1PB1-like30-129 aa
PF10551.16MULE697-775 aa
PF12678.14zf-rbx11202-1247 aa
PF13639.13zf-RING_21205-1247 aa
PF17123.12zf-RING_111205-1233 aa
PF13923.13zf-C3HC4_21206-1246 aa
PF00097.32zf-C3HC41206-1246 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_035285PF26130.1PB1-like301292.9e-1660.3
LXL04_035285PF10551.16MULE6977752.9e-1041.1
LXL04_035285PF12678.14zf-rbx1120212475.9e-0833.5
LXL04_035285PF13639.13zf-RING_2120512474.9e-1246.6
LXL04_035285PF17123.12zf-RING_11120512333.7e-0730.4
LXL04_035285PF13923.13zf-C3HC4_2120612461.3e-0628.8
LXL04_035285PF00097.32zf-C3HC4120612465.5e-0626.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q8L649Arabidopsis thalianaE3 ubiquitin-protein ligase BIG BROTHER51.456%Swiss-Protweak database homology
Q9LT17Arabidopsis thalianaE3 ubiquitin ligase BIG BROTHER-related37.725%Swiss-Protweak database homology
Q9FMM4Arabidopsis thalianaProbable E3 ubiquitin-protein ligase RHG1A45.263%Swiss-Protweak database homology
O49500Arabidopsis thalianaE3 ubiquitin-protein ligase MBR242.553%Swiss-Protweak database homology
Q7XTV7Oryza sativa subsp. japonicaProbable E3 ubiquitin-protein ligase HIP140.816%Swiss-Protweak database homology

JBrowse

View in Genome Browser