TkA03G461180 | RubberDandelionOmics

Gene overview

TkA03G461180

Reference: TK1151 Chr: Chr03 Coordinates: 115132320-115137124 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1623 bp · TkA03G461180|TK1151|cDNA

TTCTGTCATCTATATGTCATTTAAACTTTCATAAAAAAGATTACTAATGACATATACTTCCTTTCTTGTGTAAAAATAATGAATGCCATATTTTTTTATTGATAGTAGTAAGTAACTAAGTATTAACTGGTCTCTTTGCTGTTGCTATAGGCACATAAAGACTTTAAAAAAGAAAAGATAAATGCGTTTGCATGTGATCTGACAAGTGAAGATCTGATGAACCATATATCTCCATCTTCTGTTGACATTGTAACAATGAT...

CDS

Download CDS FASTA

849 bp · TkA03G461180|TK1151|CDS

ATGTTATGGAGAAAATTAATATCTAAATGGCAGGAAAGGCTTATTTCCAAGGATCAGAAAATCAGCGAGAATTTTTTTGTCAGAGGTGACGGAACTCGTGCATTCTACTTTTCTGAGGAATTCTTGACAAATTTGTTTCAAGAAAATGGGTTTTTCATGGAAGAATGTGGAGTGTGTTGCAAGCAAGTAGAAAACCGTTCACGTGAGATAGTAATGAATCGGCGGTGGGTCCAAGCTGCCTTTCGTGTAAATGACAAAAC...

Protein

Download Protein FASTA

282 aa · TkA03G461180|TK1151|PROTEIN

MLWRKLISKWQERLISKDQKISENFFVRGDGTRAFYFSEEFLTNLFQENGFFMEECGVCCKQVENRSREIVMNRRWVQAAFRVNDKTPKVSKEDEDIDISEGFAFEMFAFLHQGTRSWSSNYEIGTSKSNYFPKNPTHVQINRTNAMGIRPTHGLNSRLKPNHSLQQTVLELGSGSGGICSMIAARTARLVVPTDGDNKTLELFKKNVATNLEKSLTPNLKIKKLEWGNEQDIESVKKESGETGSSCIGTDVTYVAEAIV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G461180`
TK1151 ID	TkA03G461180
OH-1004 ID	LXL04_009665
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	74.800
Protein coverage (%)	TK1151 91.844 / OH-1004 31.522 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G461180`
Location	Chr03:115132320-115137124 (-)
Description	Similar to Mettl6: tRNA N(3)-methylcytidine methyltransferase METTL6
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_009665` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006400 tRNA modification Biological Process GO:0030488 tRNA methylation Biological Process GO:0106217 tRNA C3-cytosine methylation Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0043527 tRNA methyltransferase complex Cellular Component GO:0019899 enzyme binding Molecular Function GO:0052735 tRNA (cytidine-3-)-methyltransferase activity Molecular Function
KEGG gene cross-reference	hsa:131965 mmu:67011 pon:100171853 rno:290564 spo:2541032 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.531

Rank 1 · TkA03G461180 · TK1151

Nucleus0.372

Rank 2 · TkA03G461180 · TK1151

Mitochondrion0.115

Rank 3 · TkA03G461180 · TK1151

Endoplasmic reticulum0.057

Rank 4 · TkA03G461180 · TK1151

Cell membrane0.057

Rank 5 · TkA03G461180 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13489Methyltransf_2330-51 aa

PF05175MTS157-212 aa

PF13489Methyltransf_23158-188 aa

PF10294Methyltransf_16159-267 aa

PF03602Cons_hypoth95164-212 aa

PF06325PrmA166-215 aa

PF13649Methyltransf_25169-210 aa

PF06325PrmA232-276 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G461180	`PF13489`	Methyltransf_23	30	51	0.045	14.2
TkA03G461180	`PF05175`	MTS	157	212	0.0023	18.3
TkA03G461180	`PF13489`	Methyltransf_23	158	188	0.045	14.2
TkA03G461180	`PF10294`	Methyltransf_16	159	267	3.3e-11	44.0
TkA03G461180	`PF03602`	Cons_hypoth95	164	212	0.021	15.2
TkA03G461180	`PF06325`	PrmA	166	215	0.039	14.2
TkA03G461180	`PF13649`	Methyltransf_25	169	210	0.05	15.0
TkA03G461180	`PF06325`	PrmA	232	276	0.039	14.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card