TkA03G456170 | RubberDandelionOmics

Gene overview

TkA03G456170

Reference: TK1151 Chr: Chr03 Coordinates: 113899851-113902729 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1527 bp · TkA03G456170|TK1151|cDNA

GAAAAAGAAAAAAGAATAAATAGTGTTTTAGGCGGAAACACAGAAACAAACATCTCTTTTCACCAAACAGACTCTTCTTGATTTGTATTCCCCCATTATTAGGGCTTGTATTCTTGTTTTGAGCAAGATTTTTAGGGCTTGTTTGTATTCTTTCTAATCGTATAAATGGATCCATCAAATCACCCTTCCGACACCGAAATGTCCGAGGCGGCTGCGGCCCCTCCTCCGTCGCAGCAGCAGCCCTTGACTGGAATCGATAA...

CDS

Download CDS FASTA

1185 bp · TkA03G456170|TK1151|CDS

ATGGATCCATCAAATCACCCTTCCGACACCGAAATGTCCGAGGCGGCTGCGGCCCCTCCTCCGTCGCAGCAGCAGCCCTTGACTGGAATCGATAACATCCCGGCAACTCTCAGCCATGGCGGTAGGTTCATCCAGTATAACATATTTGGCAACATCTTTGAAGTTACAGCTAAGTATAAACCTCCAATCATGCCCATCGGAAAAGGCGCTTACGGAATAGTCTGTTCGGCTTTAAATTCGGAGACGAGTGAGCATGTTGC...

Protein

Download Protein FASTA

394 aa · TkA03G456170|TK1151|PROTEIN

MDPSNHPSDTEMSEAAAAPPPSQQQPLTGIDNIPATLSHGGRFIQYNIFGNIFEVTAKYKPPIMPIGKGAYGIVCSALNSETSEHVAIKKIANAFDNKIDAKRTLREIKLLRHMDHENVVAIRDIIPPPERTSFNDVYIAYELMDTDLHQIIRSNQSLSEEHCQYFLYQILRGLKYIHSANVLHRDLKPSNLLLNANCDLKICDFGLARVTSETDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G456170`
TK1151 ID	TkA03G456170
OH-1004 ID	LXL04_033397
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G456170`
Location	Chr03:113899851-113902729 (+)
Description	Similar to NTF4: Mitogen-activated protein kinase homolog NTF4
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_033397` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006952 defense response Biological Process GO:0009409 response to cold Biological Process GO:0009611 response to wounding Biological Process GO:0010225 response to UV-C Biological Process GO:0035556 intracellular signal transduction Biological Process GO:0051301 cell division Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0004674 protein serine/threonine kinase activity Molecular Function GO:0004707 MAP kinase activity Molecular Function GO:0004708 MAP kinase kinase activity Molecular Function GO:0004713 protein tyrosine kinase activity Molecular Function
KEGG gene cross-reference	nta:107772177 nta:107783427 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.678

Rank 1 · TkA03G456170 · TK1151

Cytoplasm0.579

Rank 2 · TkA03G456170 · TK1151

Cell membrane0.050

Rank 3 · TkA03G456170 · TK1151

Mitochondrion0.038

Rank 4 · TkA03G456170 · TK1151

Endoplasmic reticulum0.024

Rank 5 · TkA03G456170 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase65-345 aa

PF07714PK_Tyr_Ser-Thr66-259 aa

PF06293Kdo95-198 aa

PF01163RIO195-206 aa

PF01636APH101-180 aa

PF14531Kinase-like153-249 aa

PF03109ABC1154-213 aa

PF12330Haspin_kinase159-215 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G456170	`PF00069`	Pkinase	65	345	3.8e-72	243.5
TkA03G456170	`PF07714`	PK_Tyr_Ser-Thr	66	259	2e-33	116.5
TkA03G456170	`PF06293`	Kdo	95	198	0.00082	19.6
TkA03G456170	`PF01163`	RIO1	95	206	0.026	14.8
TkA03G456170	`PF01636`	APH	101	180	0.19	12.2
TkA03G456170	`PF14531`	Kinase-like	153	249	0.011	15.7
TkA03G456170	`PF03109`	ABC1	154	213	0.0011	18.9
TkA03G456170	`PF12330`	Haspin_kinase	159	215	0.0024	17.7
TkA03G456170	`PF01636`	APH	182	210	0.19	12.2
TkA03G456170	`PF01163`	RIO1	272	303	0.026	14.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card