LXL04_033397 | RubberDandelionOmics

Gene overview

LXL04_033397

Reference: OH-1004 Chr: Chr07 Coordinates: 42720378-42722922 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1185 bp · LXL04_033397|LXL04_033397|OH1004|cDNA

ATGGATCCATCCAATCACCCTTCCGACACCGAAATGTCCGAGGCGGCTGCGGCCCCTCCTCCGTCGCAGCAGCAGCCCTTGACTGGAATCGACAACATCCCGGCAACGCTTAGCCATGGCGGTAGGTTCATCCAGTATAACATATTTGGCAACATCTTCGAAGTTACAGCTAAGTATAAACCTCCAATCATGCCCATCGGCAAAGGCGCTTACGGCATAGTCTGTTCGGCTTTAAATTCGGAGACGAGTGAGCATGTTGC...

CDS

Download CDS FASTA

1185 bp · LXL04_033397|LXL04_033397|OH1004|CDS

ATGGATCCATCCAATCACCCTTCCGACACCGAAATGTCCGAGGCGGCTGCGGCCCCTCCTCCGTCGCAGCAGCAGCCCTTGACTGGAATCGACAACATCCCGGCAACGCTTAGCCATGGCGGTAGGTTCATCCAGTATAACATATTTGGCAACATCTTCGAAGTTACAGCTAAGTATAAACCTCCAATCATGCCCATCGGCAAAGGCGCTTACGGCATAGTCTGTTCGGCTTTAAATTCGGAGACGAGTGAGCATGTTGC...

Protein

Download Protein FASTA

394 aa · LXL04_033397|LXL04_033397|OH1004|PROTEIN

MDPSNHPSDTEMSEAAAAPPPSQQQPLTGIDNIPATLSHGGRFIQYNIFGNIFEVTAKYKPPIMPIGKGAYGIVCSALNSETSEHVAIKKIANAFDNKIDAKRTLREIKLLRHMDHENVVAIRDIIPPPERTSFNDVYIAYELMDTDLHQIIRSNQSLSEEHCQYFLYQILRGLKYIHSANVLHRDLKPSNLLLNANCDLKICDFGLARVTSETDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033397`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_033397`
Location	Chr07:42720378-42722922 (+)
Description	Similar to NTF4: Mitogen-activated protein kinase homolog NTF4
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_033397` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006952 defense response Biological Process GO:0009409 response to cold Biological Process GO:0009611 response to wounding Biological Process GO:0010225 response to UV-C Biological Process GO:0035556 intracellular signal transduction Biological Process GO:0051301 cell division Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0004674 protein serine/threonine kinase activity Molecular Function GO:0004707 MAP kinase activity Molecular Function GO:0004708 MAP kinase kinase activity Molecular Function GO:0004713 protein tyrosine kinase activity Molecular Function
KEGG gene cross-reference	nta:107772177 nta:107783427 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.672

Rank 1 · LXL04_033397 · OH-1004

Cytoplasm0.584

Rank 2 · LXL04_033397 · OH-1004

Cell membrane0.050

Rank 3 · LXL04_033397 · OH-1004

Mitochondrion0.038

Rank 4 · LXL04_033397 · OH-1004

Endoplasmic reticulum0.024

Rank 5 · LXL04_033397 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase65-345 aa

PF07714.24PK_Tyr_Ser-Thr66-259 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033397	`PF00069.32`	Pkinase	65	345	3.9e-72	243.5
LXL04_033397	`PF07714.24`	PK_Tyr_Ser-Thr	66	259	2e-33	116.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card