TkA03G451800 | RubberDandelionOmics

Gene overview

TkA03G451800

Reference: TK1151 Chr: Chr03 Coordinates: 112744601-112748656 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2061 bp · TkA03G451800|TK1151|cDNA

TAAATGATGGTCAAGTTATTTGCAAACGAAATAAAAAAGGCAAAGAAAAGGGAATACGAGCCCCTCAGATTGTACATAGACACAGTGACGCTAGATCTGTTCCTGGTTCAAATCGGAAGACAAGATGGAGATCGAAAGTCTAACCGCCGATGACTCCTCAGCCACAATGGCGGAAGTGCTGCCGTTGGCATCCGTTTCTCAACAACCTTACGTCTCCGAACTCCTTTCCTTCACTCTCGATCGCCTGCACAAGGAACCGG...

CDS

Download CDS FASTA

1722 bp · TkA03G451800|TK1151|CDS

ATGGAGATCGAAAGTCTAACCGCCGATGACTCCTCAGCCACAATGGCGGAAGTGCTGCCGTTGGCATCCGTTTCTCAACAACCTTACGTCTCCGAACTCCTTTCCTTCACTCTCGATCGCCTGCACAAGGAACCGGAGCTTCTCCGCGTCGATGCTGAGAGAATTCGTAGGCAGATGCAGGAGGTTGCTGTCAACAACTACCGTGCTTTCATTTCTGCCGCCGATGCTTTGGTTTCTATTCGCCACGAAGTCTCATCAAT...

Protein

Download Protein FASTA

573 aa · TkA03G451800|TK1151|PROTEIN

MEIESLTADDSSATMAEVLPLASVSQQPYVSELLSFTLDRLHKEPELLRVDAERIRRQMQEVAVNNYRAFISAADALVSIRHEVSSIDKHLESLISEVPKLTSGCSEFIESAENILEKRKMNQTLLANHSTLLDLLEIPQLMDTCVRNGNYDEALDLEAYVNKLSTMHPKLPVIQALTAEVQQTTQSLLSQLLQKLRSNIQLPECLRIIGYLRRIGVYSEYEMRLQFLRCRESWLSGILDDLDQRNAYEYLKGMVNCHRM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G451800`
TK1151 ID	TkA03G451800
OH-1004 ID	LXL04_009621
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G451800

Location Chr03:112744601-112748656 (+)

Description Similar to COG8: Conserved oligomeric Golgi complex subunit 8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g11980`	Acts as a component of the peripheral membrane COG complex that is involved in intra-Golgi protein trafficking.	Arabidopsis COG Complex Subunits COG3 and COG8 Modulate Golgi Morphology, Vesicle Trafficking Homeostasis and Are Essential for Pollen Tube Growth.2016 · DOI: 10.1371/journal.pgen.1006140

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009621 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000301 retrograde transport, vesicle recycling within Golgi Biological Process

GO:0006891 intra-Golgi vesicle-mediated transport Biological Process

GO:0007030 Golgi organization Biological Process

GO:0007290 spermatid nucleus elongation Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0015031 protein transport Biological Process

GO:0048193 Golgi vesicle transport Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0016020 membrane Cellular Component

GO:0017119 Golgi transport complex Cellular Component

KEGG gene cross-reference

ath:AT5G11980

bta:768007

dme:Dmel_CG6488

hsa:84342

mmu:97484

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.539

Rank 1 · TkA03G451800 · TK1151

Golgi apparatus0.472

Rank 2 · TkA03G451800 · TK1151

Nucleus0.152

Rank 3 · TkA03G451800 · TK1151

Lysosome / Vacuole0.143

Rank 4 · TkA03G451800 · TK1151

Cell membrane0.106

Rank 5 · TkA03G451800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08700VPS51_Exo84_N23-103 aa

PF04124Dor130-363 aa

PF10475Vps54_N38-198 aa

PF20849TelK_muzzle46-136 aa

PF10392COG5_N48-116 aa

PF20651EXOC6_Sec15_N57-156 aa

PF09763Sec3_CC78-168 aa

PF08700VPS51_Exo84_N107-134 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G451800	`PF08700`	VPS51_Exo84_N	23	103	4.4e-13	49.8
TkA03G451800	`PF04124`	Dor1	30	363	1.4e-135	452.3
TkA03G451800	`PF10475`	Vps54_N	38	198	0.00016	21.8
TkA03G451800	`PF20849`	TelK_muzzle	46	136	0.011	16.5
TkA03G451800	`PF10392`	COG5_N	48	116	0.64	11.0
TkA03G451800	`PF20651`	EXOC6_Sec15_N	57	156	0.00052	20.7
TkA03G451800	`PF09763`	Sec3_CC	78	168	2.1	8.9
TkA03G451800	`PF08700`	VPS51_Exo84_N	107	134	4.4e-13	49.8
TkA03G451800	`PF10392`	COG5_N	148	195	0.64	11.0
TkA03G451800	`PF20849`	TelK_muzzle	161	209	0.011	16.5
TkA03G451800	`PF09763`	Sec3_CC	163	204	2.1	8.9
TkA03G451800	`PF08700`	VPS51_Exo84_N	185	187	4.4e-13	49.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84K25`	Arabidopsis thaliana	sp\|Q84K25\|COG8_ARATH Conserved oligomeric Golgi complex subunit 8	79.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card