LXL04_009621 | RubberDandelionOmics

Gene overview

LXL04_009621

Reference: OH-1004 Chr: Chr02 Coordinates: 129858981-129862628 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1722 bp · LXL04_009621|LXL04_009621|OH1004|cDNA

ATGGAGATCGAAAGTCTAACCGCCGATGACTCCTCAGCCACAATGGCGGAAGTGCTGCCGTTGGCATCCGTTTCTCAACAACCTTACGTCTCCGAACTCCTTTCCTTCACTCTCGATCGCCTGCACAAGGAACCGGAGCTTCTCCGCGTCGATGCTGAGAGAATTCGTAGGCAGATGCAGGAGGTTGCTGTCAACAACTACCGTGCTTTCATTTCTGCCGCCGATGCTTTGGTTTCTATTCGCCACGAAGTCTCATCAAT...

CDS

Download CDS FASTA

1722 bp · LXL04_009621|LXL04_009621|OH1004|CDS

ATGGAGATCGAAAGTCTAACCGCCGATGACTCCTCAGCCACAATGGCGGAAGTGCTGCCGTTGGCATCCGTTTCTCAACAACCTTACGTCTCCGAACTCCTTTCCTTCACTCTCGATCGCCTGCACAAGGAACCGGAGCTTCTCCGCGTCGATGCTGAGAGAATTCGTAGGCAGATGCAGGAGGTTGCTGTCAACAACTACCGTGCTTTCATTTCTGCCGCCGATGCTTTGGTTTCTATTCGCCACGAAGTCTCATCAAT...

Protein

Download Protein FASTA

573 aa · LXL04_009621|LXL04_009621|OH1004|PROTEIN

MEIESLTADDSSATMAEVLPLASVSQQPYVSELLSFTLDRLHKEPELLRVDAERIRRQMQEVAVNNYRAFISAADALVSIRHEVSSIDKHLESLISEVPKLTSGCSEFIESAENILEKRKMNQTLLANHSTLLDLLEIPQLMDTCVRNGNYDEALDLEAYVNKLSTMHPKLPVIQALTAEVQQTTQSLLSQLLQKLRSNIQLPECLRIIGYLRRIGVYSEYEMRLQFLRCRESWLSGILDDLDQRNAYEYLKGMVNCHRM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009621`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009621

Location Chr02:129858981-129862628 (+)

Description Similar to COG8: Conserved oligomeric Golgi complex subunit 8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g11980`	Acts as a component of the peripheral membrane COG complex that is involved in intra-Golgi protein trafficking.	Arabidopsis COG Complex Subunits COG3 and COG8 Modulate Golgi Morphology, Vesicle Trafficking Homeostasis and Are Essential for Pollen Tube Growth.2016 · DOI: 10.1371/journal.pgen.1006140

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009621 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000301 retrograde transport, vesicle recycling within Golgi Biological Process

GO:0006891 intra-Golgi vesicle-mediated transport Biological Process

GO:0007030 Golgi organization Biological Process

GO:0007290 spermatid nucleus elongation Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0015031 protein transport Biological Process

GO:0048193 Golgi vesicle transport Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0016020 membrane Cellular Component

GO:0017119 Golgi transport complex Cellular Component

KEGG gene cross-reference

ath:AT5G11980

bta:768007

dme:Dmel_CG6488

hsa:84342

mmu:97484

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.537

Rank 1 · LXL04_009621 · OH-1004

Golgi apparatus0.472

Rank 2 · LXL04_009621 · OH-1004

Nucleus0.152

Rank 3 · LXL04_009621 · OH-1004

Lysosome / Vacuole0.144

Rank 4 · LXL04_009621 · OH-1004

Cell membrane0.106

Rank 5 · LXL04_009621 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08700.18VPS51_Exo84_N23-103 aa

PF04124.19Dor130-363 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009621	`PF08700.18`	VPS51_Exo84_N	23	103	4.4e-13	49.8
LXL04_009621	`PF04124.19`	Dor1	30	363	1.4e-135	452.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84K25`	Arabidopsis thaliana	Conserved oligomeric Golgi complex subunit 8	76.732%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card