TkA03G421260 | RubberDandelionOmics

Gene overview

TkA03G421260

Reference: TK1151 Chr: Chr03 Coordinates: 104891013-104896059 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1326 bp · TkA03G421260|TK1151|cDNA

GCAAGCAGGAAGATGTTGTTGTAAAGCTGATAGATTTCATGTTGACCCCTCATGCCACAACCAGTGAGCTCATTTCAGAGAAAGAACAGTCAAGCAAGGGTAAAAAGCGTACATCAAGCAGCAAGAAAAGCACACCACCTTCAAAAAGCTCATCTAAGAAGCAGAAAACTAAAAGCAATTCAGAAGAGGATGACAAGAAGAATTCAGACACAGACGAATCTGAAGATGAAGATGAGAAAGATGATGAAGAACATGAAAAC...

CDS

Download CDS FASTA

2013 bp · TkA03G421260|TK1151|CDS

ATGGGGGAGGAAGATGCGGCACCTGAAGTTGCAGAGGCAGTGCCGAATGGGACTGTCTCTCAGGACACAGCAGCCAAAGATGTGATTGAGAAAAAGGAGGAAAAGGTAGAAATAGAGGTCGAAAAGGAAGAAAAAGAGGACAAGGAAGAAAAGGAGGATAAAGATGGAGTAAAAGAGATGGATGAAGATGTCAAAGAAGATGAGAAAGATAAAACCAAAGAAGCTGATGTTGACAAGGAAGATGCTGAGGTAAGCAAAGA...

Protein

Download Protein FASTA

670 aa · TkA03G421260|TK1151|PROTEIN

MGEEDAAPEVAEAVPNGTVSQDTAAKDVIEKKEEKVEIEVEKEEKEDKEEKEDKDGVKEMDEDVKEDEKDKTKEADVDKEDAEVSKDAKKEEDEVKDAKKEEEEEVKDANKEEEEEVKDAKKEEEEEEVKDNKKEEEKEVEEEEEEKVNEEPKSEPMDVDKQEEVEEIEKEETDDKKTEVADSDMKEVEEKKEQVPEEKVSKTFSRKKSGVDKNNNTETKKETNTKASSEKKRKEKKKEPTPTPTTPVAPISERPVRERK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G421260`
TK1151 ID	TkA03G421260
OH-1004 ID	LXL04_016157
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	95.200
Protein coverage (%)	TK1151 100.000 / OH-1004 97.097 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G421260

Location Chr03:104891013-104896059 (-)

Description Similar to DEK: Protein DEK

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g55660`	Chromatin-associated protein which contributes to the modulation of chromatin structure (such as super-helical structure of DNA) and function (By similarity).	No verified direct reference in this release
`At4g26630`	Chromatin-associated protein which contributes to the modulation of chromatin structure (such as super-helical structure of DNA) and function.	A DEK domain-containing protein modulates chromatin structure and function in Arabidopsis.2014 · DOI: 10.1105/tpc.114.129254
`At5g63550`	Chromatin-associated protein which contributes to the modulation of chromatin structure (such as super-helical structure of DNA) and function (By similarity).	No verified direct reference in this release
`At3g48710`	Chromatin-associated protein which contributes to the modulation of chromatin structure (such as super-helical structure of DNA) and function (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016157 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006325 chromatin organization Biological Process

GO:0006338 chromatin remodeling Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0006366 transcription by RNA polymerase II Biological Process

GO:0007165 signal transduction Biological Process

GO:0009651 response to salt stress Biological Process

GO:0019079 viral genome replication Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0045943 positive regulation of transcription by RNA polymerase I Biological Process

GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process

KEGG gene cross-reference

ath:AT3G48710

ath:AT4G26630

ath:AT5G55660

ath:AT5G63550

hsa:7913

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.971

Rank 1 · TkA03G421260 · TK1151

Cytoplasm0.080

Rank 2 · TkA03G421260 · TK1151

Cell membrane0.021

Rank 3 · TkA03G421260 · TK1151

Endoplasmic reticulum0.011

Rank 4 · TkA03G421260 · TK1151

Extracellular0.009

Rank 5 · TkA03G421260 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08766DEK_C596-648 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G421260	`PF08766`	DEK_C	596	648	8.9e-15	55.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4K4Y5`	Arabidopsis thaliana	sp\|F4K4Y5\|DEKP4_ARATH DEK domain-containing chromatin-associated protein 4	60.200%	Swiss-Prot	Medium
`Q9SUA1`	Arabidopsis thaliana	sp\|Q9SUA1\|DEKP3_ARATH DEK domain-containing chromatin-associated protein 3	55.200%	Swiss-Prot	Medium
`Q84JB7`	Arabidopsis thaliana	sp\|Q84JB7\|DEKP2_ARATH DEK domain-containing chromatin-associated protein 2	51.300%	Swiss-Prot	Low
`Q9SMM8`	Arabidopsis thaliana	sp\|Q9SMM8\|DEKP1_ARATH DEK domain-containing chromatin-associated protein 1	49.400%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card