TkA03G407770 | RubberDandelionOmics

Gene overview

TkA03G407770

Reference: TK1151 Chr: Chr03 Coordinates: 101357999-101362104 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1896 bp · TkA03G407770|TK1151|cDNA

ATGAATCCACCAATTCCAGCTACTGGATCATCATCGAATCCTGCTCCTAACTCATCCTCTGTAAAAGGCAATGATACTCAAATGTTTTTGGTATCAAATCTTCTTAGCGGCAACGAAAATTACATGCAATGGAAGTTTTCAATTCAATTAGCACTTGGAGGCAAAAAGAAGACTGGATTCATTGACGGTACTTCAACAAAACCAGCATCGGAAGGAAATGATCTCGATGAATGGATGAGCAATGATTGCATGATACAAAT...

CDS

Download CDS FASTA

1896 bp · TkA03G407770|TK1151|CDS

ATGAATCCACCAATTCCAGCTACTGGATCATCATCGAATCCTGCTCCTAACTCATCCTCTGTAAAAGGCAATGATACTCAAATGTTTTTGGTATCAAATCTTCTTAGCGGCAACGAAAATTACATGCAATGGAAGTTTTCAATTCAATTAGCACTTGGAGGCAAAAAGAAGACTGGATTCATTGACGGTACTTCAACAAAACCAGCATCGGAAGGAAATGATCTCGATGAATGGATGAGCAATGATTGCATGATACAAAT...

Protein

Download Protein FASTA

631 aa · TkA03G407770|TK1151|PROTEIN

MNPPIPATGSSSNPAPNSSSVKGNDTQMFLVSNLLSGNENYMQWKFSIQLALGGKKKTGFIDGTSTKPASEGNDLDEWMSNDCMIQINFNSSTEVSAMLAKSSNYNTNTKKSFHFKPRNDNKGKNARDRYCDHCKITGHTKDVCFKIHGYPDWYKDLKEKKKTNLNSAHMANNSYNHTNETPLHESDDNKQGNDPNMEDVLQQFTQFIRSNQKTDSHFANMSHFGDFAVQLNQTHTGLIVLNPRLTLKNILHVPGFTCNL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G407770`
TK1151 ID	TkA03G407770
OH-1004 ID	LXL04_025587
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	30.500
Protein coverage (%)	TK1151 96.672 / OH-1004 67.749 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G407770

Location Chr03:101357999-101362104 (+)

Description Similar to PAPP5: Serine/threonine-protein phosphatase 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g02960`	Retrovirus-related Pol polyprotein from transposon RE2.	No verified direct reference in this release
`UniProt: Q94HW2`	Retrovirus-related Pol polyprotein from transposon RE1.	No verified direct reference in this release
`UniProt: P93290`	Uncharacterized mitochondrial protein AtMg00240.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025587 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0001933 negative regulation of protein phosphorylation Biological Process

GO:0006470 protein dephosphorylation Biological Process

GO:0006913 nucleocytoplasmic transport Biological Process

GO:0010017 red or far-red light signaling pathway Biological Process

GO:0010019 chloroplast-nucleus signaling pathway Biological Process

GO:0010288 response to lead ion Biological Process

GO:0043278 response to morphine Biological Process

GO:0043409 negative regulation of MAPK cascade Biological Process

GO:0070262 peptidyl-serine dephosphorylation Biological Process

GO:0070301 cellular response to hydrogen peroxide Biological Process

GO:0071276 cellular response to cadmium ion Biological Process

GO:1902325 negative regulation of chlorophyll biosynthetic process Biological Process

KEGG gene cross-reference

ath:AT2G42810

mmu:19060

rno:65179

sly:543849

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.619

Rank 1 · TkA03G407770 · TK1151

Nucleus0.401

Rank 2 · TkA03G407770 · TK1151

Mitochondrion0.082

Rank 3 · TkA03G407770 · TK1151

Cell membrane0.033

Rank 4 · TkA03G407770 · TK1151

Peroxisome0.032

Rank 5 · TkA03G407770 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14244Retrotran_gag_328-69 aa

PF22936Pol_BBD215-267 aa

PF07727RVT_2423-461 aa

PF07727RVT_2458-488 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G407770	`PF14244`	Retrotran_gag_3	28	69	3.5e-12	46.6
TkA03G407770	`PF22936`	Pol_BBD	215	267	0.00021	22.3
TkA03G407770	`PF07727`	RVT_2	423	461	2e-06	28.3
TkA03G407770	`PF07727`	RVT_2	458	488	2e-06	28.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZT94`	Arabidopsis thaliana	sp\|Q9ZT94\|POLR2_ARATH Retrovirus-related Pol polyprotein from transposon RE2	47.700%	Swiss-Prot	Low
`Q94HW2`	Arabidopsis thaliana	sp\|Q94HW2\|POLR1_ARATH Retrovirus-related Pol polyprotein from transposon RE1	48.000%	Swiss-Prot	Low
`P93290`	Arabidopsis thaliana	sp\|P93290\|M240_ARATH Uncharacterized mitochondrial protein AtMg00240	43.400%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card