Gene Card
Gene overview
cDNA / CDS / Protein Sequences
5547 bp · LXL04_025587|LXL04_025587|OH1004|cDNA
ATGCCCACTATGGCTACTGAAAAATCAGACGTTTCATTGGCTGAAGAAATCAAACTCCAAGCTAATGAAGCTTTCAAAGCCAATAAGTTTTCTCAAGCAATTGATTTGTATACAAAAGCAATCGAATTAAACGGCGAGAATGCTGTATATTGGGCAAATCGAGCTTTCTCGCACACCAAGCTGGAGGAGTATGGTAGCGCTATCCAGGATGCATCCAAGGCCGTTGAAATTGATCCCAAGTATTCCAAGGGTTATTACCG...
5547 bp · LXL04_025587|LXL04_025587|OH1004|CDS
ATGCCCACTATGGCTACTGAAAAATCAGACGTTTCATTGGCTGAAGAAATCAAACTCCAAGCTAATGAAGCTTTCAAAGCCAATAAGTTTTCTCAAGCAATTGATTTGTATACAAAAGCAATCGAATTAAACGGCGAGAATGCTGTATATTGGGCAAATCGAGCTTTCTCGCACACCAAGCTGGAGGAGTATGGTAGCGCTATCCAGGATGCATCCAAGGCCGTTGAAATTGATCCCAAGTATTCCAAGGGTTATTACCG...
Protein
Download Protein FASTA1848 aa · LXL04_025587|LXL04_025587|OH1004|PROTEIN
MPTMATEKSDVSLAEEIKLQANEAFKANKFSQAIDLYTKAIELNGENAVYWANRAFSHTKLEEYGSAIQDASKAVEIDPKYSKGYYRRGAAYLAMGKFKDALKDFQQVKRISPNDPDASKKLKECEKAVMKLKFEEAISVPTSEQRSVAESIDYRTIDVESQYTGAKIDGDVITLDFVKNMMDDFKSQKCLHKRYAFQIVLQTREILMALPSLVNVNVPNEKHFTVCGDVHGQFFDLMNIFELNGLPSDENPYLFNGDFV...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_025587 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_025587 | ||||||
|---|---|---|---|---|---|---|---|
| Location | Chr05:113861806-113871490 (-) | ||||||
| Description | Similar to PAPP5: Serine/threonine-protein phosphatase 5 | ||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | ||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||
| GO annotations (OH1004 source) | GO:0001933 negative regulation of protein phosphorylation Biological Process GO:0006470 protein dephosphorylation Biological Process GO:0006913 nucleocytoplasmic transport Biological Process GO:0010017 red or far-red light signaling pathway Biological Process GO:0010019 chloroplast-nucleus signaling pathway Biological Process GO:0010288 response to lead ion Biological Process GO:0043278 response to morphine Biological Process GO:0043409 negative regulation of MAPK cascade Biological Process GO:0070262 peptidyl-serine dephosphorylation Biological Process GO:0070301 cellular response to hydrogen peroxide Biological Process GO:0071276 cellular response to cadmium ion Biological Process GO:1902325 negative regulation of chlorophyll biosynthetic process Biological Process | ||||||
| KEGG gene cross-reference | ath:AT2G42810 mmu:19060 rno:65179 sly:543849 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF25575.1TPR_BSK1_C15-86 aaPF13432.13TPR_1620-81 aaPF00515.35TPR_148-81 aaPF13414.13TPR_1160-96 aaPF13431.13TPR_1773-102 aaPF00515.35TPR_183-115 aaPF07719.24TPR_283-115 aaPF08321.19PPP5122-215 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_025587 | PF25575.1 | TPR_BSK1_C | 15 | 86 | 5.7e-10 | 39.8 |
| LXL04_025587 | PF13432.13 | TPR_16 | 20 | 81 | 1.3e-06 | 29.4 |
| LXL04_025587 | PF00515.35 | TPR_1 | 48 | 81 | 1.8e-20 | 72.5 |
| LXL04_025587 | PF13414.13 | TPR_11 | 60 | 96 | 5.9e-11 | 42.6 |
| LXL04_025587 | PF13431.13 | TPR_17 | 73 | 102 | 1.7e-09 | 37.9 |
| LXL04_025587 | PF00515.35 | TPR_1 | 83 | 115 | 1.8e-20 | 72.5 |
| LXL04_025587 | PF07719.24 | TPR_2 | 83 | 115 | 9.4e-16 | 57.3 |
| LXL04_025587 | PF08321.19 | PPP5 | 122 | 215 | 3e-29 | 101.8 |
| LXL04_025587 | PF00149.34 | Metallophos | 223 | 417 | 5e-36 | 125.7 |
| LXL04_025587 | PF14244.13 | Retrotran_gag_3 | 500 | 544 | 1.2e-09 | 38.6 |
| LXL04_025587 | PF14223.15 | Retrotran_gag_2 | 525 | 635 | 1.6e-07 | 32.0 |
| LXL04_025587 | PF22936.2 | Pol_BBD | 865 | 938 | 1.3e-15 | 58.2 |
| LXL04_025587 | PF13976.12 | gag_pre-integrs | 992 | 1052 | 1.5e-08 | 35.0 |
| LXL04_025587 | PF00665.33 | rve | 1069 | 1166 | 3e-13 | 50.6 |
| LXL04_025587 | PF29688.1 | TnsB_C | 1130 | 1181 | 3.2e-06 | 27.7 |
| LXL04_025587 | PF07727.20 | RVT_2 | 1363 | 1606 | 2.5e-73 | 247.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
| Protein | Organism | Description | Identity | Database | Confidence |
|---|---|---|---|---|---|
Q84XU2 | Arabidopsis thaliana | Serine/threonine-protein phosphatase 5 | 74.715% | Swiss-Prot | weak database homology |