TkA03G389620 | RubberDandelionOmics

Gene overview

TkA03G389620

Reference: TK1151 Chr: Chr03 Coordinates: 96512574-96516569 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1763 bp · TkA03G389620|TK1151|cDNA

GGAAATTGTGTTTTCGTGATCTTTAAAAGGGTTTGTGAAAGCAAACAATTTGGTTTCAAAAAGGTTCGTTCCACTGAATATATTAGAGAAGAAGATGCCATTAGAGACCAGCTGCTTTACTTATAAGGATCTTGTTCTTCATCAAGAAAACGTGTGCAGAGTCTTTGGCAATGGCGTTTGTGAGATTGTTAGTGATATAAGTCCTCTCATTTGTTCGTCTCCAAGGCCGACGACTAAAGAGCTCAATGCAGCAGCTCTTA...

CDS

Download CDS FASTA

1296 bp · TkA03G389620|TK1151|CDS

ATGCCATTAGAGACCAGCTGCTTTACTTATAAGGATCTTGTTCTTCATCAAGAAAACGTGTGCAGAGTCTTTGGCAATGGCGTTTGTGAGATTGTTAGTGATATAAGTCCTCTCATTTGTTCGTCTCCAAGGCCGACGACTAAAGAGCTCAATGCAGCAGCTCTTACAATTCAAAAGTTCTACAAGAGCTATCGTACTCGACGCAATCTTGCAGATTGTGCGGTAGTCGTTGAAGAATTATGGTGGAAAGCTTTGGACTT...

Protein

Download Protein FASTA

431 aa · TkA03G389620|TK1151|PROTEIN

MPLETSCFTYKDLVLHQENVCRVFGNGVCEIVSDISPLICSSPRPTTKELNAAALTIQKFYKSYRTRRNLADCAVVVEELWWKALDFATLKRSSVSFFCNNKPESAVSRWGRARTRVAKVGKGLSKDKNAQKLAICHWLEAIDPRHRYGHNLQLYYKLWFTSQSSQPFFYWLDVGDGKEITVDTCPRNVLHYQCIKYLGPKEREEYQVIIENGKFLYKQNGRLVNTIEGTKWIFVLSTSRTLYVGQKEKGRFQHSSFLAG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G389620`
TK1151 ID	TkA03G389620
OH-1004 ID	LXL04_008262
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G389620

Location Chr03:96512574-96516569 (-)

Description Similar to IQM5: IQ domain-containing protein IQM5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g57010`	May be involved in biotic and abiotic stress responses.	No verified direct reference in this release
`At2g26190`	May be involved in biotic and abiotic stress responses.	No verified direct reference in this release
`At4g33050`	Involved in the modulation of stomatal movement.	AtIQM1, a novel calmodulin-binding protein, is involved in stomatal movement in Arabidopsis.2012 · DOI: 10.1007/s11103-012-9915-0
`At3g13600`	May be involved in biotic and abiotic stress responses.	No verified direct reference in this release
`At3g58480`	May be involved in biotic and abiotic stress responses.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008262 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010119 regulation of stomatal movement Biological Process

GO:0010197 polar nucleus fusion Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0005516 calmodulin binding Molecular Function

KEGG gene cross-reference

ath:AT2G26190

ath:AT3G58480

ath:AT4G33050

ath:AT5G57010

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.531

Rank 1 · TkA03G389620 · TK1151

Nucleus0.366

Rank 2 · TkA03G389620 · TK1151

Cell membrane0.203

Rank 3 · TkA03G389620 · TK1151

Plastid0.056

Rank 4 · TkA03G389620 · TK1151

Endoplasmic reticulum0.053

Rank 5 · TkA03G389620 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08008Viral_cys_rich14-36 aa

PF00612IQ52-69 aa

PF08062NOP2_rpt122-133 aa

PF08008Viral_cys_rich136-158 aa

PF30383IQM_M202-293 aa

PF08008Viral_cys_rich292-300 aa

PF08062NOP2_rpt354-364 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G389620	`PF08008`	Viral_cys_rich	14	36	0.054	14.2
TkA03G389620	`PF00612`	IQ	52	69	0.0056	17.1
TkA03G389620	`PF08062`	NOP2_rpt	122	133	1.4	10.1
TkA03G389620	`PF08008`	Viral_cys_rich	136	158	0.054	14.2
TkA03G389620	`PF30383`	IQM_M	202	293	7.2e-45	151.8
TkA03G389620	`PF08008`	Viral_cys_rich	292	300	0.054	14.2
TkA03G389620	`PF08062`	NOP2_rpt	354	364	1.4	10.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q058N0`	Arabidopsis thaliana	sp\|Q058N0\|IQM5_ARATH IQ domain-containing protein IQM5	60.900%	Swiss-Prot	High
`O64851`	Arabidopsis thaliana	sp\|O64851\|IQM4_ARATH IQ domain-containing protein IQM4	59.500%	Swiss-Prot	High
`O82645`	Arabidopsis thaliana	sp\|O82645\|IQM1_ARATH IQ domain-containing protein IQM1	59.000%	Swiss-Prot	High
`Q9LHN9`	Arabidopsis thaliana	sp\|Q9LHN9\|IQM2_ARATH IQ domain-containing protein IQM2	44.200%	Swiss-Prot	Medium
`Q9M2G8`	Arabidopsis thaliana	sp\|Q9M2G8\|IQM6_ARATH IQ domain-containing protein IQM6	47.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card