TkA03G386670 | RubberDandelionOmics

Gene overview

TkA03G386670

Reference: TK1151 Chr: Chr03 Coordinates: 95685657-95686202 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

546 bp · TkA03G386670|TK1151|cDNA

ATGACGACTTACGGCACGATTCCGACATCATCAGGCGGAGGTTCTAATCTCGAATACCTATCTCGAGCTAAAGCTCGCATAAAATCTGGATTAGGCACGCGGCGTCCGTGGAAAGAGATGTTCAATTTCCGTTCGGTTGACTTTCCTCACGGCGTCTCCGATGCGTTTTCACGATTCAAAACGAACATAGGTTACTTTCGTATGAACTATGCAATAATCGTGCTCCTGATTTTGTTCTTTAGCCTATTGTGGCATCCGGT...

CDS

Download CDS FASTA

546 bp · TkA03G386670|TK1151|CDS

ATGACGACTTACGGCACGATTCCGACATCATCAGGCGGAGGTTCTAATCTCGAATACCTATCTCGAGCTAAAGCTCGCATAAAATCTGGATTAGGCACGCGGCGTCCGTGGAAAGAGATGTTCAATTTCCGTTCGGTTGACTTTCCTCACGGCGTCTCCGATGCGTTTTCACGATTCAAAACGAACATAGGTTACTTTCGTATGAACTATGCAATAATCGTGCTCCTGATTTTGTTCTTTAGCCTATTGTGGCATCCGGT...

Protein

Download Protein FASTA

181 aa · TkA03G386670|TK1151|PROTEIN

MTTYGTIPTSSGGGSNLEYLSRAKARIKSGLGTRRPWKEMFNFRSVDFPHGVSDAFSRFKTNIGYFRMNYAIIVLLILFFSLLWHPVSLIVFVVMMAVWLFLYFLRDEPLMIFHRIIDDGVVLVILSVATILFLLLTGATMNILSSILIGFAVVLVHAVFRNTGDLTLDEEAGGYLASSSS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G386670`
TK1151 ID	TkA03G386670
OH-1004 ID	LXL04_002138
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	72.700
Protein coverage (%)	TK1151 99.448 / OH-1004 85.514 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G386670

Location Chr03:95685657-95686202 (-)

Description Similar to PRA1F2: PRA1 family protein F2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g13720`	May be involved in both secretory and endocytic intracellular trafficking in the endosomal/prevacuolar compartments.	No verified direct reference in this release
`At1g55190`	May be involved in both secretory and endocytic intracellular trafficking in the endosomal/prevacuolar compartments.	No verified direct reference in this release
`At3g13710`	May be involved in both secretory and endocytic intracellular trafficking in the endosomal/prevacuolar compartments.	No verified direct reference in this release
`At1g17700`	May be involved in both secretory and endocytic intracellular trafficking in the endosomal/prevacuolar compartments.	No verified direct reference in this release
`At1g08770`	May be involved in both secretory and endocytic intracellular trafficking in the endosomal/prevacuolar compartments.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002138 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016192 vesicle-mediated transport Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005768 endosome Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0010008 endosome membrane Cellular Component

KEGG gene cross-reference

ath:AT1G17700

ath:AT1G55190

ath:AT2G38360

ath:AT3G13710

ath:AT3G13720

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.460

Rank 1 · TkA03G386670 · TK1151

Cytoplasm0.278

Rank 2 · TkA03G386670 · TK1151

Endoplasmic reticulum0.232

Rank 3 · TkA03G386670 · TK1151

Lysosome / Vacuole0.134

Rank 4 · TkA03G386670 · TK1151

Cell membrane0.117

Rank 5 · TkA03G386670 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03208PRA130-171 aa

PF11124Pho8682-164 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G386670	`PF03208`	PRA1	30	171	1e-50	171.8
TkA03G386670	`PF11124`	Pho86	82	164	2.3	8.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LIC6`	Arabidopsis thaliana	sp\|Q9LIC6\|PR1F3_ARATH PRA1 family protein F3	60.900%	Swiss-Prot	High
`Q9C889`	Arabidopsis thaliana	sp\|Q9C889\|PR1F2_ARATH PRA1 family protein F2	59.700%	Swiss-Prot	High
`Q9LIC7`	Arabidopsis thaliana	sp\|Q9LIC7\|PR1F4_ARATH PRA1 family protein F4	59.900%	Swiss-Prot	High
`Q9FZ63`	Arabidopsis thaliana	sp\|Q9FZ63\|PR1F1_ARATH PRA1 family protein F1	46.600%	Swiss-Prot	Medium
`Q9FRR1`	Arabidopsis thaliana	sp\|Q9FRR1\|PRA1E_ARATH PRA1 family protein E	42.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card