LXL04_002138 | RubberDandelionOmics

Gene overview

LXL04_002138

Reference: OH-1004 Chr: Chr01 Coordinates: 42482576-42483220 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

645 bp · LXL04_002138|LXL04_002138|OH1004|cDNA

ATGCCCCGATCTCCCTCTCTATTGTACCGCCCTATTTCGGACACCAAATACTCCCAGCCCTTGCCGCCGATTCTTCGACTGCCGGTAACCATGACGACGTACGGCACAGTTTCGACGTCATCTGGCGGAGGTACGAATCTCGAATTCCTTACTCGCGCAAAAGATCGCATACAAACAGGACTTGGCACCCGACGTCCATGGAAGGAGATGTTCAACCTCGGTTCGATCAACTTTCCTCAAGGCATCTCCGAAGCGTTTTC...

CDS

Download CDS FASTA

645 bp · LXL04_002138|LXL04_002138|OH1004|CDS

ATGCCCCGATCTCCCTCTCTATTGTACCGCCCTATTTCGGACACCAAATACTCCCAGCCCTTGCCGCCGATTCTTCGACTGCCGGTAACCATGACGACGTACGGCACAGTTTCGACGTCATCTGGCGGAGGTACGAATCTCGAATTCCTTACTCGCGCAAAAGATCGCATACAAACAGGACTTGGCACCCGACGTCCATGGAAGGAGATGTTCAACCTCGGTTCGATCAACTTTCCTCAAGGCATCTCCGAAGCGTTTTC...

Protein

Download Protein FASTA

214 aa · LXL04_002138|LXL04_002138|OH1004|PROTEIN

MPRSPSLLYRPISDTKYSQPLPPILRLPVTMTTYGTVSTSSGGGTNLEFLTRAKDRIQTGLGTRRPWKEMFNLGSINFPQGISEAFSRVKTNIGYFRMNYAIVVLVILFLSLLWHPISLIVLTVLMAAWLFLYFLRGEPLTIFHRVIDDRVVLGVLSVVTIVLLLLTDATMNIVLSILGGIVLVLIHAVLRKTEDLYLDEEGLEAGGYLVASSP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002138`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002138

Location Chr01:42482576-42483220 (-)

Description Similar to PRA1F2: PRA1 family protein F2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g55190`	May be involved in both secretory and endocytic intracellular trafficking in the endosomal/prevacuolar compartments.	No verified direct reference in this release
`At3g13710`	May be involved in both secretory and endocytic intracellular trafficking in the endosomal/prevacuolar compartments.	No verified direct reference in this release
`At3g13720`	May be involved in both secretory and endocytic intracellular trafficking in the endosomal/prevacuolar compartments.	No verified direct reference in this release
`At1g17700`	May be involved in both secretory and endocytic intracellular trafficking in the endosomal/prevacuolar compartments.	No verified direct reference in this release
`At2g38360`	May be involved in both secretory and endocytic intracellular trafficking in the endosomal/prevacuolar compartments.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002138 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0016192 vesicle-mediated transport Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005768 endosome Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0010008 endosome membrane Cellular Component

KEGG gene cross-reference

ath:AT1G17700

ath:AT1G55190

ath:AT2G38360

ath:AT3G13710

ath:AT3G13720

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.380

Rank 1 · LXL04_002138 · OH-1004

Endoplasmic reticulum0.296

Rank 2 · LXL04_002138 · OH-1004

Cytoplasm0.248

Rank 3 · LXL04_002138 · OH-1004

Lysosome / Vacuole0.155

Rank 4 · LXL04_002138 · OH-1004

Cell membrane0.131

Rank 5 · LXL04_002138 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03208.25PRA161-201 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002138	`PF03208.25`	PRA1	61	201	2.1e-52	177.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C889`	Arabidopsis thaliana	PRA1 family protein F2	58.242%	Swiss-Prot	strong database homology
`Q9LIC7`	Arabidopsis thaliana	PRA1 family protein F4	59.281%	Swiss-Prot	strong database homology
`Q9LIC6`	Arabidopsis thaliana	PRA1 family protein F3	60.920%	Swiss-Prot	strong database homology
`Q9FZ63`	Arabidopsis thaliana	PRA1 family protein F1	53.448%	Swiss-Prot	strong database homology
`O80915`	Arabidopsis thaliana	PRA1 family protein B4	37.195%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card