TkA03G385960 | RubberDandelionOmics

Gene overview

TkA03G385960

Reference: TK1151 Chr: Chr03 Coordinates: 95488265-95492339 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2349 bp · TkA03G385960|TK1151|cDNA

AACTTTTTAGCTTAAAAAAAAAAAAAAGCTAAAATAACTAATAAGATGATTTTGAAGGAATCCCAAACACCCTCTTGATTAAAAGTTCTCGTGTCTTTGGTTCTGACCCGGTTTGGTGTTAAAGGAAAACTGCATCAAGAAGAAGCAATGACCGGTGGTGATGGAGATGTCAAAGCAGCTCCGGCGGGTCCGCCACCGCCGCTTGACTGGAAGTTCTCTCAGGTATTTGGTGAACGCACCGCCGGTGAAGAAGTTCAAGA...

CDS

Download CDS FASTA

1551 bp · TkA03G385960|TK1151|CDS

ATGACCGGTGGTGATGGAGATGTCAAAGCAGCTCCGGCGGGTCCGCCACCGCCGCTTGACTGGAAGTTCTCTCAGGTATTTGGTGAACGCACCGCCGGTGAAGAAGTTCAAGAAGTTGATATCATTTCGGCTATAGAGTTTGATAAAAGCGGTGACCATCTTGCCACTGGTGATCGTGGTGGCAGGGTGGTATTATTCGAGAGGACTGATACAAAAGAGCATGGTGGAAGTAGAAAGGATTTAGAGAAGACAGATTACTC...

Protein

Download Protein FASTA

516 aa · TkA03G385960|TK1151|PROTEIN

MTGGDGDVKAAPAGPPPPLDWKFSQVFGERTAGEEVQEVDIISAIEFDKSGDHLATGDRGGRVVLFERTDTKEHGGSRKDLEKTDYSSGRHPEFRYKTEFQSHEPEFDYLKSLEIEEKINKIKWCQTANGAVFLLSTNDKTIKFWKVQEKKVKKIADMNMDVSKAIGNGNPASSSSYKSSHGVNGEYTDKSYTSLTKDLSIQSLRLPVVVTSNETSLVARCRRVYAHAHDYHINSISNNSDAETFISADDLRINLWNLEI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G385960`
TK1151 ID	TkA03G385960
OH-1004 ID	LXL04_008316
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 97.170 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G385960

Location Chr03:95488265-95492339 (-)

Description Similar to PP2AB2: Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B beta isoform

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g17720`	The B regulatory subunit may modulate substrate selectivity and catalytic activity, and may also direct the localization of the catalytic enzyme to a particular subcellular compartment.	No verified direct reference in this release
`At1g51690`	The B regulatory subunit may modulate substrate selectivity and catalytic activity, and may also direct the localization of the catalytic enzyme to a particular subcellular compartment.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0563300`	The B regulatory subunit may modulate substrate selectivity and catalytic activity, and may also direct the localization of the catalytic enzyme to a particular subcellular compartment.	No verified direct reference in this release
`UniProt: A2X2K3`	The B regulatory subunit may modulate substrate selectivity and catalytic activity, and may also direct the localization of the catalytic enzyme to a particular subcellular compartment.	No verified direct reference in this release
`Os02g0224200`	The B regulatory subunit may modulate substrate selectivity and catalytic activity, and may also direct the localization of the catalytic enzyme to a particular subcellular compartment.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008316 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006470 protein dephosphorylation Biological Process

GO:0000159 protein phosphatase type 2A complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0019888 protein phosphatase regulator activity Molecular Function

KEGG gene cross-reference

ath:AT1G17720

ath:AT1G51690

dosa:Os02g0224200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.699

Rank 1 · TkA03G385960 · TK1151

Cytoplasm0.306

Rank 2 · TkA03G385960 · TK1151

Cell membrane0.066

Rank 3 · TkA03G385960 · TK1151

Lysosome / Vacuole0.059

Rank 4 · TkA03G385960 · TK1151

Golgi apparatus0.044

Rank 5 · TkA03G385960 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24782WD40_MABP1-WDR62_2nd31-71 aa

PF23409Beta-prop_EML34-71 aa

PF23098Beta-prop_NOL10_N35-67 aa

PF24807WD40_CDC20-Fz37-73 aa

PF23414Beta-prop_EML_237-74 aa

PF24814WD40_Prp1939-70 aa

PF24817WD40_WDHD1_1st40-72 aa

PF00400WD4042-66 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G385960	`PF24782`	WD40_MABP1-WDR62_2nd	31	71	9.9e-05	22.2
TkA03G385960	`PF23409`	Beta-prop_EML	34	71	9.6e-05	22.7
TkA03G385960	`PF23098`	Beta-prop_NOL10_N	35	67	7.9e-06	26.0
TkA03G385960	`PF24807`	WD40_CDC20-Fz	37	73	4.7e-08	33.4
TkA03G385960	`PF23414`	Beta-prop_EML_2	37	74	3.3e-05	24.1
TkA03G385960	`PF24814`	WD40_Prp19	39	70	9.3e-12	45.3
TkA03G385960	`PF24817`	WD40_WDHD1_1st	40	72	1.8e-08	34.7
TkA03G385960	`PF00400`	WD40	42	66	4.1e-15	56.2
TkA03G385960	`PF25174`	Beta-prop_THOC3	42	69	1.7e-13	50.9
TkA03G385960	`PF25175`	Beta-prop_WDR5	42	68	3.1e-12	47.1
TkA03G385960	`PF23381`	Beta-prop_IFT122_1st	42	73	4.3e-12	46.7
TkA03G385960	`PF25173`	Beta-prop_WDR3_1st	42	68	8.5e-07	29.6
TkA03G385960	`PF23383`	Beta-prop_IFT140_1st	42	71	0.0011	18.5
TkA03G385960	`PF23393`	Beta-prop_WDR90_POC16_2nd	43	67	9.5e-05	22.5
TkA03G385960	`PF23775`	Beta-prop_RIG_2nd	46	73	2e-07	31.4
TkA03G385960	`PF23775`	Beta-prop_RIG_2nd	110	155	2e-07	31.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q39247`	Arabidopsis thaliana	sp\|Q39247\|2ABB_ARATH Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B beta isoform	81.400%	Swiss-Prot	High
`Q38821`	Arabidopsis thaliana	sp\|Q38821\|2ABA_ARATH Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform	78.300%	Swiss-Prot	High
`Q5Z8Z7`	Oryza sativa subsp. japonica	sp\|Q5Z8Z7\|2ABA_ORYSJ Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform	76.600%	Swiss-Prot	High
`A2X2K3`	Oryza sativa subsp. indica	sp\|A2X2K3\|2ABB_ORYSI Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B beta isoform	78.300%	Swiss-Prot	High
`Q0E2P1`	Oryza sativa subsp. japonica	sp\|Q0E2P1\|2ABB_ORYSJ Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B beta isoform	78.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card