LXL04_008316 | RubberDandelionOmics

Gene overview

LXL04_008316

Reference: OH-1004 Chr: Chr02 Coordinates: 96424424-96427683 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1598 bp · LXL04_008316|LXL04_008316|OH1004|cDNA

TGGTTCTGACCCGGTTTGGTGTTAAAGGAAAACTGCATCAAGAAGAAGCAATGACCGGTGGTGATGGAGATGTCAAAGCAGCTCCGGCGGGTCCGCCACCGCCGCTTGACTGGAAGTTCTCTCAGGTATTTGGTGAACGCACCGCCGgtgaagaagttcaagaagTTGATATCATTTCGGCTATAGAGTTTGATAAAAGCGGTGACCATCTTGCCACTGGTGATCGTGGTGGCAGGGTGGTATTATTCGAGAGGACTGAT...

CDS

Download CDS FASTA

1593 bp · LXL04_008316|LXL04_008316|OH1004|CDS

CTGACCCGGTTTGGTGTTAAAGGAAAACTGCATCAAGAAGAAGCAATGACCGGTGGTGATGGAGATGTCAAAGCAGCTCCGGCGGGTCCGCCACCGCCGCTTGACTGGAAGTTCTCTCAGGTATTTGGTGAACGCACCGCCGGTGAAGAAGTTCAAGAAGTTGATATCATTTCGGCTATAGAGTTTGATAAAAGCGGTGACCATCTTGCCACTGGTGATCGTGGTGGCAGGGTGGTATTATTCGAGAGGACTGATACAAA...

Protein

Download Protein FASTA

530 aa · LXL04_008316|LXL04_008316|OH1004|PROTEIN

MTRFGVKGKLHQEEAMTGGDGDVKAAPAGPPPPLDWKFSQVFGERTAGEEVQEVDIISAIEFDKSGDHLATGDRGGRVVLFERTDTKEHGGSRKDLEKTDYSSGRHPEFRYKTEFQSHEPEFDYLKSLEIEEKINKIKWCQTANGAVFLLSTNDKTIKFWKVQEKKVKKIADMNMDVSKAIGNGNPASSSSYKSSHGVNGEYTDKSYTSLTKDLSIQSLRLPVVTSNETSLVARCRRVYAHAHDYHINSISNNSDAETFI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008316`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_008316

Location Chr02:96424424-96427683 (+)

Description Similar to PP2AB2: Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B beta isoform

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g17720`	The B regulatory subunit may modulate substrate selectivity and catalytic activity, and may also direct the localization of the catalytic enzyme to a particular subcellular compartment.	No verified direct reference in this release
`At1g51690`	The B regulatory subunit may modulate substrate selectivity and catalytic activity, and may also direct the localization of the catalytic enzyme to a particular subcellular compartment.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0224200`	The B regulatory subunit may modulate substrate selectivity and catalytic activity, and may also direct the localization of the catalytic enzyme to a particular subcellular compartment.	No verified direct reference in this release
`UniProt: A2X2K3`	The B regulatory subunit may modulate substrate selectivity and catalytic activity, and may also direct the localization of the catalytic enzyme to a particular subcellular compartment.	No verified direct reference in this release
`Os06g0563300`	The B regulatory subunit may modulate substrate selectivity and catalytic activity, and may also direct the localization of the catalytic enzyme to a particular subcellular compartment.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008316 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006470 protein dephosphorylation Biological Process

GO:0000159 protein phosphatase type 2A complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0019888 protein phosphatase regulator activity Molecular Function

KEGG gene cross-reference

ath:AT1G17720

ath:AT1G51690

dosa:Os02g0224200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.686

Rank 1 · LXL04_008316 · OH-1004

Cytoplasm0.303

Rank 2 · LXL04_008316 · OH-1004

Cell membrane0.068

Rank 3 · LXL04_008316 · OH-1004

Lysosome / Vacuole0.061

Rank 4 · LXL04_008316 · OH-1004

Golgi apparatus0.047

Rank 5 · LXL04_008316 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24814.2WD40_Prp19240-381 aa

PF25174.2Beta-prop_THOC3243-327 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_008316	`PF24814.2`	WD40_Prp19	240	381	1.1e-11	45.0
LXL04_008316	`PF25174.2`	Beta-prop_THOC3	243	327	1.7e-13	50.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q39247`	Arabidopsis thaliana	Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B beta isoform	81.165%	Swiss-Prot	strong database homology
`Q38821`	Arabidopsis thaliana	Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform	78.143%	Swiss-Prot	strong database homology
`Q0E2P1`	Oryza sativa subsp. japonica	Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B beta isoform	79.276%	Swiss-Prot	strong database homology
`A2X2K3`	Oryza sativa subsp. indica	Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B beta isoform	79.276%	Swiss-Prot	strong database homology
`Q5Z8Z7`	Oryza sativa subsp. japonica	Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform	75.385%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card