TkA03G366870 | RubberDandelionOmics

Gene overview

TkA03G366870

Reference: TK1151 Chr: Chr03 Coordinates: 90501380-90504742 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2500 bp · TkA03G366870|TK1151|cDNA

TTTTGGTCCGTAAAGGGCGAATCTGATGGGAGATATAGCAGGACTCCCGTTGAAATCGATTGAGATTTCAGTCGTCCAAACCTCAAATAGAAAGAAACACAAGCGAATCTATCATAATCCCAAATGATGGGGTTTGCAATGGGAAGTTCATCTCCTTTACACTCCTCAACTTATCACTCTATTTTCCCATCTTTTTCTTCATCTTCGCAGCCCCTTTTCTTCCACTCTTGCCAAAGAAAACCACATGATTTCAGTAAGAA...

CDS

Download CDS FASTA

867 bp · TkA03G366870|TK1151|CDS

ATGATGGGGTTTGCAATGGGAAGTTCATCTCCTTTACACTCCTCAACTTATCACTCTATTTTCCCATCTTTTTCTTCATCTTCGCAGCCCCTTTTCTTCCACTCTTGCCAAAGAAAACCACATGATTTCAGTAAGAAAAGAAAAGTTCAGGCCTGTATGCAACACCATGAACCCAACGAAGACAACTTCTGCCAGAGAAGAGTGATTCTCTTCATGGGTGCTTCCGTTCTTCCGTTCTTGAATTTAAAATCAAGAGCTGC...

Protein

Download Protein FASTA

288 aa · TkA03G366870|TK1151|PROTEIN

MMGFAMGSSSPLHSSTYHSIFPSFSSSSQPLFFHSCQRKPHDFSKKRKVQACMQHHEPNEDNFCQRRVILFMGASVLPFLNLKSRAAENSAPDELEDSARAQERSQMAEVSTNGDSTPNPFLTLSSGLGIVASGVLGAFYALAQKEKSANMLTIESMTTKLVEKEAAIVSMQKSFESKLQTEKEEKNEQLKKSNQEKQSLMSQLSSANSTVKGLGQELQKENKVIQDLQNQIDGLNADLKKAFDDKEDLKLQVKDKLFSI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G366870`
TK1151 ID	TkA03G366870
OH-1004 ID	LXL04_008490
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	89.400
Protein coverage (%)	TK1151 98.611 / OH-1004 38.639 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G366870`
Location	Chr03:90501380-90504742 (-)
Description	Similar to MFP1-1: MAR-binding filament-like protein 1-1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_008490` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0007155 cell adhesion Biological Process GO:0007165 signal transduction Biological Process GO:0009888 tissue development Biological Process GO:0010581 regulation of starch biosynthetic process Biological Process GO:0019252 starch biosynthetic process Biological Process GO:0030334 regulation of cell migration Biological Process GO:0045785 positive regulation of cell adhesion Biological Process GO:0045995 regulation of embryonic development Biological Process GO:0110011 regulation of basement membrane organization Biological Process GO:2001046 positive regulation of integrin-mediated signaling pathway Biological Process GO:0005576 extracellular region Cellular Component GO:0005604 basement membrane Cellular Component
KEGG gene cross-reference	ath:AT3G16000 hsa:3908 mmu:16773 nta:107792739 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.973

Rank 1 · TkA03G366870 · TK1151

Mitochondrion0.029

Rank 2 · TkA03G366870 · TK1151

Nucleus0.026

Rank 3 · TkA03G366870 · TK1151

Cytoplasm0.015

Rank 4 · TkA03G366870 · TK1151

Cell membrane0.011

Rank 5 · TkA03G366870 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21521MYO6_lever48-66 aa

PF17082Spc2975-110 aa

PF29336ATG33122-235 aa

PF08614ATG16122-244 aa

PF19842YqeC138-220 aa

PF28869LMNTD2_N144-223 aa

PF11559ADIP147-232 aa

PF08702Fib_alpha147-180 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G366870	`PF21521`	MYO6_lever	48	66	0.24	12.5
TkA03G366870	`PF17082`	Spc29	75	110	1.1	9.7
TkA03G366870	`PF29336`	ATG33	122	235	1.3	9.7
TkA03G366870	`PF08614`	ATG16	122	244	2.1	9.2
TkA03G366870	`PF19842`	YqeC	138	220	0.26	12.2
TkA03G366870	`PF28869`	LMNTD2_N	144	223	0.51	11.6
TkA03G366870	`PF11559`	ADIP	147	232	0.0029	18.4
TkA03G366870	`PF08702`	Fib_alpha	147	180	2.4	9.1
TkA03G366870	`PF27636`	CCPG1_N	147	237	2.8	9.2
TkA03G366870	`PF25443`	ANG-1	150	237	4.4	8.2
TkA03G366870	`PF21521`	MYO6_lever	152	241	0.24	12.5
TkA03G366870	`PF24627`	PUMA_CC	154	178	0.002	18.8
TkA03G366870	`PF30378`	CEP135_TSGA10_CC	154	284	0.02	14.0
TkA03G366870	`PF30677`	CCDC18_1st	155	247	0.0047	16.9
TkA03G366870	`PF02601`	Exonuc_VII_L	155	246	0.17	12.1
TkA03G366870	`PF14362`	DUF4407	157	273	0.13	12.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card