TkA03G363910 | RubberDandelionOmics

Gene overview

TkA03G363910

Reference: TK1151 Chr: Chr03 Coordinates: 89777171-89781864 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3986 bp · TkA03G363910|TK1151|cDNA

CTCATTGATCAAATATGAATTTGTTATTACAACATTGGGGTCTTTGGATATTGGCTTTAAACTAAAGGGCCCTATATACCAATTGGAAAACTGAAAGGGACCCTTCTTCTTCCGTCAGCATGAGTACCCGGCACGTGTGACTTCTCTCCTCAGTTTCAGACAAATTTCCCTCACTCTCTCTCACACGAAAACGCCGTAGCAGATTGGTGTTCATCTACTTTACACGCTAAAAAGGGGGCGAACAGAATCATACTTATTGC...

CDS

Download CDS FASTA

1926 bp · TkA03G363910|TK1151|CDS

ATGGATGAATATAATCGAATAGATGTGCAAAGAACCTCAGGGAGACAAGGTTCACGCCCAGTCTTGAAGTCCATATTATCAGGTAAATCAACACCTAGAGGATCTCCCTCATTTAAAAGATTAAACTCTAGCCGTACCCCTAGAAGAGACGGAAGAACAGGTGGATTTGGTACCAATTGTTTCAGAAGCAATCGGATCGTTCTTTGGTTGCTTTTAATCACTCTTTGGGCTTACGCTGGATTCTATGTCCAATCAAGGTG...

Protein

Download Protein FASTA

641 aa · TkA03G363910|TK1151|PROTEIN

MDEYNRIDVQRTSGRQGSRPVLKSILSGKSTPRGSPSFKRLNSSRTPRRDGRTGGFGTNCFRSNRIVLWLLLITLWAYAGFYVQSRWAHGDNKEGIFGGTDTIDETETESEQVHRRDLSVSNDSLTGHLSINVNQSNVRNTDTVKIKNTIVKKRTRRSRRGSKRKKGLETEITKNLEVQEEELPNTNSTYGMLFGPFGSLEDKVLEWSPTKRSGTCDRKSQFARLVWSRKFVLIFHELSMTGAPLSMMELATELLSCGAT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G363910`
TK1151 ID	TkA03G363910
OH-1004 ID	LXL04_007208
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	33.800
Protein coverage (%)	TK1151 62.246 / OH-1004 78.542 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G363910`
Location	Chr03:89777171-89781864 (-)
Description	Similar to lpsB: Lipopolysaccharide core biosynthesis mannosyltransferase LpsB (Rhizobium meliloti (strain 1021)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_007208` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006488 dolichol-linked oligosaccharide biosynthetic process Biological Process GO:0010125 mycothiol biosynthetic process Biological Process GO:0071793 bacillithiol biosynthetic process Biological Process GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0012505 endomembrane system Cellular Component GO:0000033 alpha-1,3-mannosyltransferase activity Molecular Function GO:0000166 nucleotide binding Molecular Function GO:0000287 magnesium ion binding Molecular Function GO:0004378 GDP-Man:Man(1)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase activity Molecular Function GO:0008375 acetylglucosaminyltransferase activity Molecular Function GO:0016757 glycosyltransferase activity Molecular Function GO:0102704 GDP-Man:Man(2)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase activity Molecular Function
KEGG gene cross-reference	ban:BA_1558 bar:GBAA_1558 bat:BAS1445 kfl:Kfla_1007 mja:MJ_1178 ncr:NCU03503 sme:SMc01219 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.680

Rank 1 · TkA03G363910 · TK1151

Endoplasmic reticulum0.171

Rank 2 · TkA03G363910 · TK1151

Cytoplasm0.088

Rank 3 · TkA03G363910 · TK1151

Cell membrane0.076

Rank 4 · TkA03G363910 · TK1151

Extracellular0.063

Rank 5 · TkA03G363910 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF19860DUF6334139-148 aa

PF13524Glyco_trans_1_2206-261 aa

PF16994Glyco_trans_4_5227-396 aa

PF19860DUF6334282-356 aa

PF00534Glycos_transf_1421-615 aa

PF20706GT4-conflict481-579 aa

PF13692Glyco_trans_1_4509-600 aa

PF13524Glyco_trans_1_2523-625 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G363910	`PF19860`	DUF6334	139	148	0.14	12.9
TkA03G363910	`PF13524`	Glyco_trans_1_2	206	261	2e-08	35.0
TkA03G363910	`PF16994`	Glyco_trans_4_5	227	396	3.5e-72	242.3
TkA03G363910	`PF19860`	DUF6334	282	356	0.14	12.9
TkA03G363910	`PF00534`	Glycos_transf_1	421	615	4.5e-22	79.1
TkA03G363910	`PF20706`	GT4-conflict	481	579	3.7e-05	23.6
TkA03G363910	`PF13692`	Glyco_trans_1_4	509	600	2e-15	58.0
TkA03G363910	`PF13524`	Glyco_trans_1_2	523	625	2e-08	35.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card