TkA03G350340 | RubberDandelionOmics

Gene overview

TkA03G350340

Reference: TK1151 Chr: Chr03 Coordinates: 86260985-86262340 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

404 bp · TkA03G350340|TK1151|cDNA

ACATGGGACTATGTGACTCTTGAGAAAGCCTCAGAATTTAAAGGTGAAATACATTGTGAACAATCAAACAATTCCCTCTATACCTTCACTGGAAATTTGCTACTTCAAAAGCAAACTATACCCATTGGTCCAAATCAAATTCTATTGCGAGGATGCAGTCTACGTAATACAGAGTACATTGTTGGGACTGTAATATTTACTAGAGACGAGACTAAGGTAATGATGAATGCCATGAATGTACCTTCCAAAAGGAGTACACT...

CDS

Download CDS FASTA

345 bp · TkA03G350340|TK1151|CDS

ACATGGGACTATGTGACTCTTGAGAAAGCCTCAGAATTTAAAGGTGAAATACATTGTGAACAATCAAACAATTCCCTCTATACCTTCACTGGAAATTTGCTACTTCAAAAGCAAACTATACCCATTGGTCCAAATCAAATTCTATTGCGAGGATGCAGTCTACGTAATACAGAGTACATTGTTGGGACTGTAATATTTACTAGAGACGAGACTAAGGTAATGATGAATGCCATGAATGTACCTTCCAAAAGGAGTACACT...

Protein

Download Protein FASTA

114 aa · TkA03G350340|TK1151|PROTEIN

TWDYVTLEKASEFKGEIHCEQSNNSLYTFTGNLLLQKQTIPIGPNQILLRGCSLRNTEYIVGTVIFTRDETKVMMNAMNVPSKRSTLERKLDKVIATLFGVLLYLCLIGAIEDM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G350340`
TK1151 ID	TkA03G350340
OH-1004 ID	LXL04_020980
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	94.600
Protein coverage (%)	TK1151 97.368 / OH-1004 9.106 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G350340

Location Chr03:86260985-86262340 (-)

Description Similar to ALA3: Phospholipid-transporting ATPase 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g59820`	Involved in transport of phospholipids.	The Arabidopsis P4-ATPase ALA3 localizes to the golgi and requires a beta-subunit to function in lipid translocation and secretory vesicle formation.2008 · DOI: 10.1105/tpc.107.054767 IRREGULAR TRICHOME BRANCH 2 (ITB2) encodes a putative aminophospholipid translocase that regulates trichome branch elongation in Arabidopsis.2009 · DOI: 10.1111/j.1365-313x.2009.03954.x Intracellular targeting signals and lipid specificity determinants of the ALA/ALIS P4-ATPase complex reside in the catalytic ALA alpha-subunit.2010 · DOI: 10.1091/mbc.e09-08-0656 Loss of the Arabidopsis thaliana P₄-ATPase ALA3 reduces adaptability to temperature stresses and impairs vegetative, pollen, and ovule development.2013 · DOI: 10.1371/journal.pone.0062577 An Arabidopsis Lipid Flippase Is Required for Timely Recruitment of Defenses to the Host-Pathogen Interface at the Plant Cell Surface.2017 · DOI: 10.1016/j.molp.2017.04.003
`At1g13210`	Involved in transport of phospholipids.	No verified direct reference in this release
`At3g25610`	Involved in transport of phospholipids.	No verified direct reference in this release
`At1g26130`	Involved in transport of phospholipids.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020980 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002237 response to molecule of bacterial origin Biological Process

GO:0002238 response to molecule of fungal origin Biological Process

GO:0006893 Golgi to plasma membrane transport Biological Process

GO:0008104 intracellular protein localization Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0015031 protein transport Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0045332 phospholipid translocation Biological Process

GO:0048194 Golgi vesicle budding Biological Process

GO:0048364 root development Biological Process

KEGG gene cross-reference

ath:AT1G13210

ath:AT1G59820

ath:AT1G68710

ath:AT3G25610

ath:AT3G27870

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.578

Rank 1 · TkA03G350340 · TK1151

Golgi apparatus0.212

Rank 2 · TkA03G350340 · TK1151

Cell membrane0.187

Rank 3 · TkA03G350340 · TK1151

Cytoplasm0.157

Rank 4 · TkA03G350340 · TK1151

Lysosome / Vacuole0.092

Rank 5 · TkA03G350340 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13314DUF408379-96 aa

PF13314DUF408399-108 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G350340	`PF13314`	DUF4083	79	96	0.28	11.9
TkA03G350340	`PF13314`	DUF4083	99	108	0.28	11.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9XIE6`	Arabidopsis thaliana	sp\|Q9XIE6\|ALA3_ARATH Phospholipid-transporting ATPase 3	76.600%	Swiss-Prot	High
`Q9SAF5`	Arabidopsis thaliana	sp\|Q9SAF5\|ALA11_ARATH Probable phospholipid-transporting ATPase 11	49.000%	Swiss-Prot	Medium
`Q9LI83`	Arabidopsis thaliana	sp\|Q9LI83\|ALA10_ARATH Phospholipid-transporting ATPase 10	45.000%	Swiss-Prot	Medium
`P57792`	Arabidopsis thaliana	sp\|P57792\|ALA12_ARATH Probable phospholipid-transporting ATPase 12	46.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card