TkA03G349950 | RubberDandelionOmics

Gene overview

TkA03G349950

Reference: TK1151 Chr: Chr03 Coordinates: 86158349-86158983 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

504 bp · TkA03G349950|TK1151|cDNA

ATGTTTCAATCGAGGTTTCAATCTGTTAAAACAATAATAAGAATAGTAGATGAGATTGAGACCTTGGTTAAGCGATGTGCGAGTTCTTCAGCAGCTCGATCAAGAAGCATTAATTTGTTCGTAAGTAATACTTCAGTGAAATTCGACACCCATGGACTCTTTTTGAGAAGCTCGATAGGTCCATTTCAATACGAATTAGAAAATGGCGACGATGAATATGACGACTACTTACAGCAGCCTGAAAAGAAAAGACGCCTCAA...

CDS

Download CDS FASTA

504 bp · TkA03G349950|TK1151|CDS

ATGTTTCAATCGAGGTTTCAATCTGTTAAAACAATAATAAGAATAGTAGATGAGATTGAGACCTTGGTTAAGCGATGTGCGAGTTCTTCAGCAGCTCGATCAAGAAGCATTAATTTGTTCGTAAGTAATACTTCAGTGAAATTCGACACCCATGGACTCTTTTTGAGAAGCTCGATAGGTCCATTTCAATACGAATTAGAAAATGGCGACGATGAATATGACGACTACTTACAGCAGCCTGAAAAGAAAAGACGCCTCAA...

Protein

Download Protein FASTA

167 aa · TkA03G349950|TK1151|PROTEIN

MFQSRFQSVKTIIRIVDEIETLVKRCASSSAARSRSINLFVSNTSVKFDTHGLFLRSSIGPFQYELENGDDEYDDYLQQPEKKRRLKPDQVQFLEKSFETDNKLEPDRKIQLAKDLGLQPRQIAIWFQNRRARWKTKQLEKDYDVLQESFNELKSKYENLLQEKKKN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G349950`
TK1151 ID	TkA03G349950
OH-1004 ID	LXL04_036867
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	96.500
Protein coverage (%)	TK1151 68.263 / OH-1004 52.535 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G349950

Location Chr03:86158349-86158983 (-)

Description Similar to HAT5: Homeobox-leucine zipper protein HAT5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g01470`	Probable transcription activator involved in leaf development.	Ectopic expression of the Arabidopsis transcriptional activator Athb-1 alters leaf cell fate in tobacco.1995 · DOI: 10.1105/tpc.7.11.1773
`At1g69780`	Probable transcription factor that may act in the sucrose-signaling pathway.	No verified direct reference in this release
`At5g65310`	Probable transcription factor that acts as a positive regulator of ABA-responsiveness, mediating the inhibitory effect of ABA on growth during seedling establishment.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2XD08`	Probable transcription factor.	No verified direct reference in this release
`Os03g0170600`	Probable transcription factor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036867 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009637 response to blue light Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009733 response to auxin Biological Process

GO:0009744 response to sucrose Biological Process

GO:0009965 leaf morphogenesis Biological Process

GO:0017148 negative regulation of translation Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0048826 cotyledon morphogenesis Biological Process

GO:0080022 primary root development Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

KEGG gene cross-reference

ath:AT1G69780

ath:AT3G01220

ath:AT3G01470

dosa:Os08g0481400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.938

Rank 1 · TkA03G349950 · TK1151

Cytoplasm0.143

Rank 2 · TkA03G349950 · TK1151

Mitochondrion0.020

Rank 3 · TkA03G349950 · TK1151

Cell membrane0.017

Rank 4 · TkA03G349950 · TK1151

Endoplasmic reticulum0.008

Rank 5 · TkA03G349950 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF27021BOS1_GOSR2_MEM11-like_N8-27 aa

PF27021BOS1_GOSR2_MEM11-like_N72-84 aa

PF00046Homeodomain82-135 aa

PF21074GDH_C94-166 aa

PF05920Homeobox_KN106-133 aa

PF27021BOS1_GOSR2_MEM11-like_N130-165 aa

PF02183HALZ137-166 aa

PF00046Homeodomain145-152 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G349950	`PF27021`	BOS1_GOSR2_MEM11-like_N	8	27	3.9	8.5
TkA03G349950	`PF27021`	BOS1_GOSR2_MEM11-like_N	72	84	3.9	8.5
TkA03G349950	`PF00046`	Homeodomain	82	135	9.5e-18	64.5
TkA03G349950	`PF21074`	GDH_C	94	166	0.012	15.5
TkA03G349950	`PF05920`	Homeobox_KN	106	133	5.5e-05	23.7
TkA03G349950	`PF27021`	BOS1_GOSR2_MEM11-like_N	130	165	3.9	8.5
TkA03G349950	`PF02183`	HALZ	137	166	4.5e-09	37.0
TkA03G349950	`PF00046`	Homeodomain	145	152	9.5e-18	64.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q02283`	Arabidopsis thaliana	sp\|Q02283\|HAT5_ARATH Homeobox-leucine zipper protein HAT5	79.700%	Swiss-Prot	Low
`Q8LC03`	Arabidopsis thaliana	sp\|Q8LC03\|ATB13_ARATH Homeobox-leucine zipper protein ATHB-13	73.800%	Swiss-Prot	Low
`P46667`	Arabidopsis thaliana	sp\|P46667\|ATHB5_ARATH Homeobox-leucine zipper protein ATHB-5	74.300%	Swiss-Prot	Low
`A2XD08`	Oryza sativa subsp. indica	sp\|A2XD08\|HOX21_ORYSI Homeobox-leucine zipper protein HOX21	63.400%	Swiss-Prot	Medium
`Q8S7W9`	Oryza sativa subsp. japonica	sp\|Q8S7W9\|HOX21_ORYSJ Homeobox-leucine zipper protein HOX21	63.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card