LXL04_036867 | RubberDandelionOmics

Gene overview

LXL04_036867

Reference: OH-1004 Chr: Chr08 Coordinates: 49408268-49410492 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

654 bp · LXL04_036867|LXL04_036867|OH1004|cDNA

ATGACTGGTGCTCCTCATTCGCATGGAGAGCCTAATGAATTCAATTCGAATTACATCAAAATTTTGGCATTGAAGAACGAATTGCTCATTTGGGTCAAATTAGGTTTGAGAAGCTCGATAGGTCCATTTCAATACGAATTAGAAAATGGTGACGATGAATACGATGACTACTTACAGCAGCCTGAAAAGAAAAGACACCTCAAGTCCGATCAAGTTCAGTTCCTCGAGAAAAGCTTCGAGACAGATAACAAACTCGAGCC...

CDS

Download CDS FASTA

654 bp · LXL04_036867|LXL04_036867|OH1004|CDS

ATGACTGGTGCTCCTCATTCGCATGGAGAGCCTAATGAATTCAATTCGAATTACATCAAAATTTTGGCATTGAAGAACGAATTGCTCATTTGGGTCAAATTAGGTTTGAGAAGCTCGATAGGTCCATTTCAATACGAATTAGAAAATGGTGACGATGAATACGATGACTACTTACAGCAGCCTGAAAAGAAAAGACACCTCAAGTCCGATCAAGTTCAGTTCCTCGAGAAAAGCTTCGAGACAGATAACAAACTCGAGCC...

Protein

Download Protein FASTA

217 aa · LXL04_036867|LXL04_036867|OH1004|PROTEIN

MTGAPHSHGEPNEFNSNYIKILALKNELLIWVKLGLRSSIGPFQYELENGDDEYDDYLQQPEKKRHLKSDQVQFLEKSFETDNKLEPDRKIQLAKDLGLQPRQIAIWFQNRRARWKTKQLEKDYDVLQESFNELKSKYENLLQEKEKLKSELQFSSNDSAEAFGGITESKIRRRRAHVFRFWVENNSSFGGRDIEAGLRWKSVTMNQSEIDDLSRDA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036867`
TK1151 ID	TkA03G349950
OH-1004 ID	LXL04_036867
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	96.500
Protein coverage (%)	TK1151 68.263 / OH-1004 52.535 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036867

Location Chr08:49408268-49410492 (-)

Description Similar to HAT5: Homeobox-leucine zipper protein HAT5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g01470`	Probable transcription activator involved in leaf development.	Ectopic expression of the Arabidopsis transcriptional activator Athb-1 alters leaf cell fate in tobacco.1995 · DOI: 10.1105/tpc.7.11.1773
`At3g01220`	Probable transcription factor.	No verified direct reference in this release
`At1g69780`	Probable transcription factor that may act in the sucrose-signaling pathway.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0481400`	Probable transcription factor.	No verified direct reference in this release
`UniProt: A2YWC0`	Probable transcription factor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036867 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009637 response to blue light Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009733 response to auxin Biological Process

GO:0009744 response to sucrose Biological Process

GO:0009965 leaf morphogenesis Biological Process

GO:0017148 negative regulation of translation Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0048826 cotyledon morphogenesis Biological Process

GO:0080022 primary root development Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

KEGG gene cross-reference

ath:AT1G69780

ath:AT3G01220

ath:AT3G01470

dosa:Os08g0481400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.956

Rank 1 · LXL04_036867 · OH-1004

Cytoplasm0.101

Rank 2 · LXL04_036867 · OH-1004

Cell membrane0.023

Rank 3 · LXL04_036867 · OH-1004

Plastid0.015

Rank 4 · LXL04_036867 · OH-1004

Endoplasmic reticulum0.014

Rank 5 · LXL04_036867 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00046.36Homeodomain63-116 aa

PF02183.24HALZ118-153 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036867	`PF00046.36`	Homeodomain	63	116	3.9e-17	62.5
LXL04_036867	`PF02183.24`	HALZ	118	153	2.3e-12	47.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q02283`	Arabidopsis thaliana	Homeobox-leucine zipper protein HAT5	64.894%	Swiss-Prot	weak database homology
`Q8LAT0`	Arabidopsis thaliana	Homeobox-leucine zipper protein ATHB-20	48.684%	Swiss-Prot	moderate database homology
`Q8LC03`	Arabidopsis thaliana	Homeobox-leucine zipper protein ATHB-13	61.905%	Swiss-Prot	weak database homology
`Q6Z248`	Oryza sativa subsp. japonica	Homeobox-leucine zipper protein HOX20	52.679%	Swiss-Prot	weak database homology
`A2YWC0`	Oryza sativa subsp. indica	Homeobox-leucine zipper protein HOX20	52.679%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card