TkA03G344290 | RubberDandelionOmics

Gene overview

TkA03G344290

Reference: TK1151 Chr: Chr03 Coordinates: 84678413-84680679 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1949 bp · TkA03G344290|TK1151|cDNA

CACAATCCTGATACCAACGAACCTATATATTAAAGGATCAAAAACCCTAGTAGACGAGAGTACAACCACGAGAAGAGACCCAATGACTTCGCCGGAGAAGCGATGCCTTTACGAAGTCCTTGGTCTCCCTCGCGATTGCACCCCCGACGAGATCCGCTCGGCCTACAGAAAGCTCGCCCTCCAACGCCACCCGGACAAGCTAATCAAGTCCGGCGTCAGCGAAGCAGAAGCCACCGCTTCCTTCCAGGAGCTCGTCAATG...

CDS

Download CDS FASTA

1680 bp · TkA03G344290|TK1151|CDS

ATGACTTCGCCGGAGAAGCGATGCCTTTACGAAGTCCTTGGTCTCCCTCGCGATTGCACCCCCGACGAGATCCGCTCGGCCTACAGAAAGCTCGCCCTCCAACGCCACCCGGACAAGCTAATCAAGTCCGGCGTCAGCGAAGCAGAAGCCACCGCTTCCTTCCAGGAGCTCGTCAATGCTTACGAGGTTCTCTCCGATGTGCGAGAGCGCACATGGTACGACTCTCACCGCTCCCAAATCCTCTTTTCCAGCTCAAACTC...

Protein

Download Protein FASTA

559 aa · TkA03G344290|TK1151|PROTEIN

MTSPEKRCLYEVLGLPRDCTPDEIRSAYRKLALQRHPDKLIKSGVSEAEATASFQELVNAYEVLSDVRERTWYDSHRSQILFSSSNSNKSSSGSAVVPDLMSFFSNSVYSGFSDKGKGFYKVYADVFDKIYRNELNFAKKLGLGDVVKEAPLMGNLDSPYAQVNAFYGYWLGFVTVMDFVWEDEYDATAGPNRKSRRLMEDENKKIRKKAKREYNETVRGLAEFVKKRDKRVIDMQMKRNEEIEKKKEEERARKKEQEKV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G344290`
TK1151 ID	TkA03G344290
OH-1004 ID	LXL04_015275
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	96.900
Protein coverage (%)	TK1151 40.787 / OH-1004 49.672 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G344290

Location Chr03:84678413-84680679 (+)

Description Similar to JJJ1: DNAJ protein JJJ1 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g74250`	DNAJ protein JJJ1 homolog.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015275 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006457 protein folding Biological Process

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005840 ribosome Cellular Component

GO:0003676 nucleic acid binding Molecular Function

GO:0003723 RNA binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G74250

bta:509302

dre:336984

hsa:134218

mmu:78244

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.727

Rank 1 · TkA03G344290 · TK1151

Cytoplasm0.298

Rank 2 · TkA03G344290 · TK1151

Cell membrane0.042

Rank 3 · TkA03G344290 · TK1151

Endoplasmic reticulum0.036

Rank 4 · TkA03G344290 · TK1151

Mitochondrion0.030

Rank 5 · TkA03G344290 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00226DnaJ9-74 aa

PF23447DUF712869-85 aa

PF21884ZUO1-like_ZHD119-232 aa

PF14871GHL6261-300 aa

PF23949TSTD2_N290-332 aa

PF26408DUF8106293-318 aa

PF12756zf-C2H2_2295-330 aa

PF23447DUF7128295-318 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G344290	`PF00226`	DnaJ	9	74	4.1e-20	72.4
TkA03G344290	`PF23447`	DUF7128	69	85	0.41	11.3
TkA03G344290	`PF21884`	ZUO1-like_ZHD	119	232	2e-21	77.3
TkA03G344290	`PF14871`	GHL6	261	300	0.0079	17.1
TkA03G344290	`PF23949`	TSTD2_N	290	332	2.7	8.6
TkA03G344290	`PF26408`	DUF8106	293	318	1.2	9.7
TkA03G344290	`PF12756`	zf-C2H2_2	295	330	2.7e-05	25.1
TkA03G344290	`PF23447`	DUF7128	295	318	0.41	11.3
TkA03G344290	`PF13465`	zf-H2C2_2	295	308	0.55	11.4
TkA03G344290	`PF13248`	Zn_ribbon_3	296	309	0.6	10.4
TkA03G344290	`PF09723`	Zn_ribbon_8	296	307	6.4	7.6
TkA03G344290	`PF12171`	zf-C2H2_jaz	297	322	2e-12	47.6
TkA03G344290	`PF12874`	zf-met	297	321	2.1e-07	31.8
TkA03G344290	`PF13894`	zf-C2H2_4	297	318	7.4e-05	23.8
TkA03G344290	`PF00096`	zf-C2H2	297	318	0.00091	20.3
TkA03G344290	`PF25095`	C2H2-zf_KIN17	297	323	0.043	14.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C911`	Arabidopsis thaliana	sp\|Q9C911\|JJJ1_ARATH DNAJ protein JJJ1 homolog	48.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card