TkA03G339670 | RubberDandelionOmics

Gene overview

TkA03G339670

Reference: TK1151 Chr: Chr03 Coordinates: 83592733-83594666 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1474 bp · TkA03G339670|TK1151|cDNA

TTTTACTCCAACAATTACTAAAGTAGCCGCAGAAGAATCAAGAAACCTCTCCAAGTTTCATAATCCTTGATGGAAGTAGTCACATATGTCATAATCTTAAGTCCATAAGCGACTCTCTTATCCCTTACCTCAAATCCCTAACCAAATCAAGCACACACTTTCCATCTTCAAAATTACCAAAAGTGTACACACCTCATTCACCATTGACTTGACGTTGACCCTCCACTGGAAGAAATTTACATCCACATGTAGTATCCCCG...

CDS

Download CDS FASTA

750 bp · TkA03G339670|TK1151|CDS

ATGTTGATGTCACATATGGAATCAAAGGGACAAAGATGGCCAAGCGTTAGATTGGCAGATATAGGAGACGTATCTTCTGCTTTTAATTATGGAATTTCCGACATAATGATGAACAACTTATGGGCTTACGATCTTAGCTTGCTTGAAGAACCACAAAACGATCACATTTCTGGGTTCCCTGAACAAGCGTCATCTGAGTTCACAGTTTCTGATCCTACTTTATCTTCAAATTTTGTCGTTGACATTCAGCAAAACATAGA...

Protein

Download Protein FASTA

249 aa · TkA03G339670|TK1151|PROTEIN

MLMSHMESKGQRWPSVRLADIGDVSSAFNYGISDIMMNNLWAYDLSLLEEPQNDHISGFPEQASSEFTVSDPTLSSNFVVDIQQNIENDDPNFIKPPSEDTTFKNTEIIESKPTQKSIKGPRSKRSRRTVFESPWTPSMDLYGSNDNQQSAMSKRTLMDDVNEPTFKIQKGGNLDLNSESSGKSVNSVGRWLEDVGFGRYADVFEMHEVDEEALPLLTLDDLKEMGVHAVGPRRKLYAAISRLRGEYVN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G339670`
TK1151 ID	TkA03G339670
OH-1004 ID	LXL04_008738
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 81.373 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G339670`
Location	Chr03:83592733-83594666 (+)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_008738` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000165 MAPK cascade Biological Process GO:0006402 mRNA catabolic process Biological Process GO:0007368 determination of left/right symmetry Biological Process GO:0032232 negative regulation of actin filament bundle assembly Biological Process GO:0045794 negative regulation of cell volume Biological Process GO:0050808 synapse organization Biological Process GO:0090090 negative regulation of canonical Wnt signaling pathway Biological Process GO:0097113 AMPA glutamate receptor clustering Biological Process GO:0097114 NMDA glutamate receptor clustering Biological Process GO:0097117 guanylate kinase-associated protein clustering Biological Process GO:1900451 positive regulation of glutamate receptor signaling pathway Biological Process GO:0005737 cytoplasm Cellular Component
KEGG gene cross-reference	hsa:80114 mmu:83675 xla:398169 xla:495436 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.940

Rank 1 · TkA03G339670 · TK1151

Cytoplasm0.135

Rank 2 · TkA03G339670 · TK1151

Cell membrane0.037

Rank 3 · TkA03G339670 · TK1151

Endoplasmic reticulum0.022

Rank 4 · TkA03G339670 · TK1151

Plastid0.017

Rank 5 · TkA03G339670 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00536SAM_1182-244 aa

PF07647SAM_2183-243 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G339670	`PF00536`	SAM_1	182	244	1.3e-17	64.6
TkA03G339670	`PF07647`	SAM_2	183	243	3.9e-16	59.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card