Gene Card
Gene overview
cDNA / CDS / Protein Sequences
921 bp · LXL04_008738|LXL04_008738|OH1004|cDNA
ATGGCCTACCACGACTCACACTATGGTTCTTCGGTCCATTATTTACAATCGAGACAACTTGAAACATATCCACTGAAATCCAATTCACACGAAACTGTTTCGTCTACGACTGCATCACCCCTCTACAAGATTCGGGTTTTCCGAGAATTCAATTTTACAAACTTGGGGATAATGTTGATGTCACATATGGAATCAAAGGGACAAAGATGGCCAAGCGTTAGATTGGGAGATATAGGAGACGTATCTTCTGCTTTTAATTA...
921 bp · LXL04_008738|LXL04_008738|OH1004|CDS
ATGGCCTACCACGACTCACACTATGGTTCTTCGGTCCATTATTTACAATCGAGACAACTTGAAACATATCCACTGAAATCCAATTCACACGAAACTGTTTCGTCTACGACTGCATCACCCCTCTACAAGATTCGGGTTTTCCGAGAATTCAATTTTACAAACTTGGGGATAATGTTGATGTCACATATGGAATCAAAGGGACAAAGATGGCCAAGCGTTAGATTGGGAGATATAGGAGACGTATCTTCTGCTTTTAATTA...
Protein
Download Protein FASTA306 aa · LXL04_008738|LXL04_008738|OH1004|PROTEIN
MAYHDSHYGSSVHYLQSRQLETYPLKSNSHETVSSTTASPLYKIRVFREFNFTNLGIMLMSHMESKGQRWPSVRLGDIGDVSSAFNYGISDIMMNNLWAYDLSLLEEPQNDHISGFPEQASSEFTVSDPTLSSNFVVDIQQNIENDDPNFIKPLSEDTTFKNTEIIESKPTQKSIKGPRSKRSRRTVFESPWTPSMDLYGSNDNQQSAMSKRTLMDDVNEPTFKIQKGGNLDLNSESSGKSVNSVGRWLEDVGFGRYADV...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_008738 |
|---|---|
| TK1151 ID | TkA03G339670 |
| OH-1004 ID | LXL04_008738 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 99.200 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 81.373Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_008738 |
|---|---|
| Location | Chr02:107519027-107521407 (-) |
| Description | Protein of unknown function |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000165 MAPK cascade Biological Process GO:0006402 mRNA catabolic process Biological Process GO:0007368 determination of left/right symmetry Biological Process GO:0032232 negative regulation of actin filament bundle assembly Biological Process GO:0045794 negative regulation of cell volume Biological Process GO:0050808 synapse organization Biological Process GO:0090090 negative regulation of canonical Wnt signaling pathway Biological Process GO:0097113 AMPA glutamate receptor clustering Biological Process GO:0097114 NMDA glutamate receptor clustering Biological Process GO:0097117 guanylate kinase-associated protein clustering Biological Process GO:1900451 positive regulation of glutamate receptor signaling pathway Biological Process GO:0005737 cytoplasm Cellular Component |
| KEGG gene cross-reference | hsa:80114 mmu:83675 xla:398169 xla:495436 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00536.38SAM_1239-301 aaPF07647.25SAM_2240-300 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_008738 | PF00536.38 | SAM_1 | 239 | 301 | 1.4e-17 | 64.6 |
| LXL04_008738 | PF07647.25 | SAM_2 | 240 | 300 | 4.7e-16 | 59.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.