TkA03G316750 | RubberDandelionOmics

Gene overview

TkA03G316750

Reference: TK1151 Chr: Chr03 Coordinates: 77769476-77769829 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

354 bp · TkA03G316750|TK1151|cDNA

ATGAGAAAAATATGGCCATTGATGGTAGTGGGACCCACAGTTCCTTCATCGCAACTCGACAAACAATTAAAAGACGATTCAGATTACGGAATAAGTCTCCTAAAACCAAATCACATCGAATGCATGGAATGGCTAAACAACAAACAAAACGGATCAGTTGTCTACGTGTCATTTGGGTGTTACGGTGAACTGACACCCGAACAAATGGAAGAAGTTGCATGGGGTTTGAACGAGAGCAATGTAGATTACTTATGGGTTGT...

CDS

Download CDS FASTA

354 bp · TkA03G316750|TK1151|CDS

ATGAGAAAAATATGGCCATTGATGGTAGTGGGACCCACAGTTCCTTCATCGCAACTCGACAAACAATTAAAAGACGATTCAGATTACGGAATAAGTCTCCTAAAACCAAATCACATCGAATGCATGGAATGGCTAAACAACAAACAAAACGGATCAGTTGTCTACGTGTCATTTGGGTGTTACGGTGAACTGACACCCGAACAAATGGAAGAAGTTGCATGGGGTTTGAACGAGAGCAATGTAGATTACTTATGGGTTGT...

Protein

Download Protein FASTA

117 aa · TkA03G316750|TK1151|PROTEIN

MRKIWPLMVVGPTVPSSQLDKQLKDDSDYGISLLKPNHIECMEWLNNKQNGSVVYVSFGCYGELTPEQMEEVAWGLNESNVDYLWVVRETEKEKLPKGFVTNGLIVGWCKQLEVLSH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G316750`
TK1151 ID	TkA03G316750
OH-1004 ID	LXL04_002219
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	94.000
Protein coverage (%)	TK1151 100.000 / OH-1004 9.742 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G316750

Location Chr03:77769476-77769829 (+)

Description Similar to SAC2: Phosphoinositide phosphatase SAC2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g05675`	UDP-glycosyltransferase 74E1.	No verified direct reference in this release
`At1g05680`	Glucosyltransferase that acts on the auxin indole-3-butyric acid (IBA).	Perturbation of indole-3-butyric acid homeostasis by the UDP-glucosyltransferase UGT74E2 modulates Arabidopsis architecture and water stress tolerance.2010 · DOI: 10.1105/tpc.109.071316
`At1g24100`	Involved in the biosynthesis of glucosinolate.	Arabidopsis glucosyltransferase UGT74B1 functions in glucosinolate biosynthesis and auxin homeostasis.2004 · DOI: 10.1111/j.1365-313x.2004.02261.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002219 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007010 cytoskeleton organization Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0009832 plant-type cell wall biogenesis Biological Process

GO:0036092 phosphatidylinositol-3-phosphate biosynthetic process Biological Process

GO:0046856 phosphatidylinositol dephosphorylation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0004438 phosphatidylinositol-3-phosphate phosphatase activity Molecular Function

GO:0043812 phosphatidylinositol-4-phosphate phosphatase activity Molecular Function

KEGG gene cross-reference

ath:AT1G17340

ath:AT1G22620

ath:AT3G14205

ath:AT3G43220

ath:AT5G20840

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.437

Rank 1 · TkA03G316750 · TK1151

Endoplasmic reticulum0.172

Rank 2 · TkA03G316750 · TK1151

Nucleus0.114

Rank 3 · TkA03G316750 · TK1151

Peroxisome0.102

Rank 4 · TkA03G316750 · TK1151

Lysosome / Vacuole0.097

Rank 5 · TkA03G316750 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00201UDPGT30-117 aa

PF02875Mur_ligase_C43-92 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G316750	`PF00201`	UDPGT	30	117	6.8e-07	29.2
TkA03G316750	`PF02875`	Mur_ligase_C	43	92	0.064	14.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P0C7P7`	Arabidopsis thaliana	sp\|P0C7P7\|U74E1_ARATH UDP-glycosyltransferase 74E1	51.200%	Swiss-Prot	High
`Q9SYK9`	Arabidopsis thaliana	sp\|Q9SYK9\|U74E2_ARATH UDP-glycosyltransferase 74E2	51.200%	Swiss-Prot	High
`O48676`	Arabidopsis thaliana	sp\|O48676\|U74B1_ARATH UDP-glycosyltransferase 74B1	52.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card