LXL04_002219 | RubberDandelionOmics

Gene overview

LXL04_002219

Reference: OH-1004 Chr: Chr01 Coordinates: 43906017-43912193 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3606 bp · LXL04_002219|LXL04_002219|OH1004|cDNA

ATGAGGCTCGGGGATCCGGATTGCGGAACGATGACTTCAGAAGATGACCAACGAGATTGGATCAGAGAGGTCCCCAAAGTCAGCAATGCCTATCTGCAGAAATTCAGACTCTACGAGACTCGCTCTAACTTTTATATGATTGGACGGAGTAAAGATAGATCAACTTGGAGAGTTTTAAAGATTGATAGGTCAGAACCTGCCGAGCTAAATATCACAGAAGATCCCACAACATACACAGAAGTTGAATGCTTGGAACTGCT...

CDS

Download CDS FASTA

3606 bp · LXL04_002219|LXL04_002219|OH1004|CDS

ATGAGGCTCGGGGATCCGGATTGCGGAACGATGACTTCAGAAGATGACCAACGAGATTGGATCAGAGAGGTCCCCAAAGTCAGCAATGCCTATCTGCAGAAATTCAGACTCTACGAGACTCGCTCTAACTTTTATATGATTGGACGGAGTAAAGATAGATCAACTTGGAGAGTTTTAAAGATTGATAGGTCAGAACCTGCCGAGCTAAATATCACAGAAGATCCCACAACATACACAGAAGTTGAATGCTTGGAACTGCT...

Protein

Download Protein FASTA

1201 aa · LXL04_002219|LXL04_002219|OH1004|PROTEIN

MRLGDPDCGTMTSEDDQRDWIREVPKVSNAYLQKFRLYETRSNFYMIGRSKDRSTWRVLKIDRSEPAELNITEDPTTYTEVECLELLKRIHDGNKSTGGLRFVTTCYGIVGFIKFLGPYYMLLITKRRKIGVICGHAVYAITKSEILPIPNSSVQPSVAYSKNENRYKKLLCSVDLTKDFYYSYSYRVMHSFQKNLSTHDKGQFLNETMFVWNEFLTSTIHNQLKNNLWTVALVYGHFKQVKLSIAEKDFKLTLIARRSR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002219`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002219

Location Chr01:43906017-43912193 (-)

Description Similar to SAC2: Phosphoinositide phosphatase SAC2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g14205`	The PI(3,5)P2 regulatory complex regulates both the synthesis and turnover of phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2).	No verified direct reference in this release
`At3g43220`	The PI(3,5)P2 regulatory complex regulates both the synthesis and turnover of phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2).	No verified direct reference in this release
`At5g20840`	The PI(3,5)P2 regulatory complex regulates both the synthesis and turnover of phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2).	No verified direct reference in this release
`At1g22620`	Phosphoinositide phosphatase which catalyzes the hydrolysis of phosphatidylinositol-3,5-bisphosphate (PtdIns(3,5)P2).	Mutation of SAC1, an Arabidopsis SAC domain phosphoinositide phosphatase, causes alterations in cell morphogenesis, cell wall synthesis, and actin organization.2005 · DOI: 10.1105/tpc.105.031377
`At1g17340`	The PI(3,5)P2 regulatory complex regulates both the synthesis and turnover of phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002219 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007010 cytoskeleton organization Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0009832 plant-type cell wall biogenesis Biological Process

GO:0036092 phosphatidylinositol-3-phosphate biosynthetic process Biological Process

GO:0046856 phosphatidylinositol dephosphorylation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0004438 phosphatidylinositol-3-phosphate phosphatase activity Molecular Function

GO:0043812 phosphatidylinositol-4-phosphate phosphatase activity Molecular Function

KEGG gene cross-reference

ath:AT1G17340

ath:AT1G22620

ath:AT3G14205

ath:AT3G43220

ath:AT5G20840

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.423

Rank 1 · LXL04_002219 · OH-1004

Nucleus0.213

Rank 2 · LXL04_002219 · OH-1004

Plastid0.151

Rank 3 · LXL04_002219 · OH-1004

Cell membrane0.137

Rank 4 · LXL04_002219 · OH-1004

Endoplasmic reticulum0.102

Rank 5 · LXL04_002219 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02383.24Syja_N107-404 aa

PF00201.25UDPGT976-1162 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002219	`PF02383.24`	Syja_N	107	404	7.1e-82	275.9
LXL04_002219	`PF00201.25`	UDPGT	976	1162	1.9e-26	93.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94A27`	Arabidopsis thaliana	Phosphoinositide phosphatase SAC2	58.764%	Swiss-Prot	moderate database homology
`Q7XZU2`	Arabidopsis thaliana	Phosphoinositide phosphatase SAC3	54.523%	Swiss-Prot	moderate database homology
`Q7XZU1`	Arabidopsis thaliana	Phosphoinositide phosphatase SAC4	53.465%	Swiss-Prot	moderate database homology
`Q7XZU3`	Arabidopsis thaliana	Phosphatidylinositol-3-phosphatase SAC1	54.502%	Swiss-Prot	weak database homology
`Q8RW97`	Arabidopsis thaliana	Phosphoinositide phosphatase SAC5	52.358%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card