TkA03G312080 | RubberDandelionOmics

Gene overview

TkA03G312080

Reference: TK1151 Chr: Chr03 Coordinates: 76705019-76705934 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

372 bp · TkA03G312080|TK1151|cDNA

ATGAGAAGCAAACTCCTCGTTGCTCAAAAGGAGATCAAAGCAGCACGTGCCTCTGAGAAATTGGCTCTCGGAGCAATCACTACAGCTTTTCAAAACCCATTTATAATCTGCTCGCTTTGCGAACCTACTAATCCCCAGGCGACTACCATTGGACCAAGGAAAACCATGGAGGTAGCCGGGAGTTATCGCAGGTGTTTGGAGCTTGCTAGAAAATCTATTGGGTGTACCAGCCCTAATCCTATGGTTGGTTGTGTTATCGT...

CDS

Download CDS FASTA

372 bp · TkA03G312080|TK1151|CDS

ATGAGAAGCAAACTCCTCGTTGCTCAAAAGGAGATCAAAGCAGCACGTGCCTCTGAGAAATTGGCTCTCGGAGCAATCACTACAGCTTTTCAAAACCCATTTATAATCTGCTCGCTTTGCGAACCTACTAATCCCCAGGCGACTACCATTGGACCAAGGAAAACCATGGAGGTAGCCGGGAGTTATCGCAGGTGTTTGGAGCTTGCTAGAAAATCTATTGGGTGTACCAGCCCTAATCCTATGGTTGGTTGTGTTATCGT...

Protein

Download Protein FASTA

123 aa · TkA03G312080|TK1151|PROTEIN

MRSKLLVAQKEIKAARASEKLALGAITTAFQNPFIICSLCEPTNPQATTIGPRKTMEVAGSYRRCLELARKSIGCTSPNPMVGCVIVGERFHPKAGQPHAEVLIPRFCFPQPPNVRGQIPTPV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G312080`
TK1151 ID	TkA03G312080
OH-1004 ID	LXL04_008914
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	72.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G312080

Location Chr03:76705019-76705934 (+)

Description Similar to PYRD: Riboflavin biosynthesis protein PYRD, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g20960`	Monofunctional pyrimidine deaminase involved in the riboflavin biosynthesis pathway.	Evolution of vitamin B2 biosynthesis: structural and functional similarity between pyrimidine deaminases of eubacterial and plant origin.2004 · DOI: 10.1074/jbc.m404406200 Identification and characterization of the missing pyrimidine reductase in the plant riboflavin biosynthesis pathway.2013 · DOI: 10.1104/pp.112.208488

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008914 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009231 riboflavin biosynthetic process Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0008270 zinc ion binding Molecular Function

GO:0008703 5-amino-6-(5-phosphoribosylamino)uracil reductase activity Molecular Function

GO:0008835 diaminohydroxyphosphoribosylaminopyrimidine deaminase activity Molecular Function

GO:0050661 NADP binding Molecular Function

KEGG gene cross-reference

ath:AT4G20960

ecj:JW0404

eco:b0414

ecoc:C3026_02020

hin:HI_0944

syn:slr0066

zma:100191772

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.392

Rank 1 · TkA03G312080 · TK1151

Nucleus0.279

Rank 2 · TkA03G312080 · TK1151

Mitochondrion0.221

Rank 3 · TkA03G312080 · TK1151

Extracellular0.088

Rank 4 · TkA03G312080 · TK1151

Cell membrane0.073

Rank 5 · TkA03G312080 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05701WEMBL1-27 aa

PF00383dCMP_cyt_deam_18-27 aa

PF00383dCMP_cyt_deam_163-89 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G312080	`PF05701`	WEMBL	1	27	0.0015	18.1
TkA03G312080	`PF00383`	dCMP_cyt_deam_1	8	27	0.15	12.7
TkA03G312080	`PF00383`	dCMP_cyt_deam_1	63	89	0.15	12.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GWP5`	Arabidopsis thaliana	sp\|Q8GWP5\|RIBD_ARATH Riboflavin biosynthesis protein PYRD, chloroplastic	55.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card