LXL04_008914 | RubberDandelionOmics

Gene overview

LXL04_008914

Reference: OH-1004 Chr: Chr02 Coordinates: 112201597-112202300 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

327 bp · LXL04_008914|LXL04_008914|OH1004|cDNA

ATGAGAAGCAAACTCCTCGCTGCTCAAAAGGAGATCAAAGCAGCACGTGCCTCTGAGAAATTGGCTCTCGGAGCAATCACTGCAGCTTTTCGAAACCCATTTATAATCTGTAATTTAACTTCCCGGAGGTGTTTGGAGCTTGCTAGAAAAGCTATTGGGTGTACCAGCCCTAATCCTATGGTTGGTTGTGTTATTGTTAAAGATGGTAAAATCATTGGTGAACGCTTTCATCCTAAAGCTGGGCAACCTCATGCTGAGGT...

CDS

Download CDS FASTA

327 bp · LXL04_008914|LXL04_008914|OH1004|CDS

ATGAGAAGCAAACTCCTCGCTGCTCAAAAGGAGATCAAAGCAGCACGTGCCTCTGAGAAATTGGCTCTCGGAGCAATCACTGCAGCTTTTCGAAACCCATTTATAATCTGTAATTTAACTTCCCGGAGGTGTTTGGAGCTTGCTAGAAAAGCTATTGGGTGTACCAGCCCTAATCCTATGGTTGGTTGTGTTATTGTTAAAGATGGTAAAATCATTGGTGAACGCTTTCATCCTAAAGCTGGGCAACCTCATGCTGAGGT...

Protein

Download Protein FASTA

108 aa · LXL04_008914|LXL04_008914|OH1004|PROTEIN

MRSKLLAAQKEIKAARASEKLALGAITAAFRNPFIICNLTSRRCLELARKAIGCTSPNPMVGCVIVKDGKIIGERFHPKAGQPHAEVLIPRFSFPQPPNVRGQIPTPV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008914`
TK1151 ID	TkA03G312080
OH-1004 ID	LXL04_008914
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	72.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_008914

Location Chr02:112201597-112202300 (-)

Description Similar to PYRD: Riboflavin biosynthesis protein PYRD, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g20960`	Monofunctional pyrimidine deaminase involved in the riboflavin biosynthesis pathway.	Evolution of vitamin B2 biosynthesis: structural and functional similarity between pyrimidine deaminases of eubacterial and plant origin.2004 · DOI: 10.1074/jbc.m404406200 Identification and characterization of the missing pyrimidine reductase in the plant riboflavin biosynthesis pathway.2013 · DOI: 10.1104/pp.112.208488

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008914 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009231 riboflavin biosynthetic process Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0008270 zinc ion binding Molecular Function

GO:0008703 5-amino-6-(5-phosphoribosylamino)uracil reductase activity Molecular Function

GO:0008835 diaminohydroxyphosphoribosylaminopyrimidine deaminase activity Molecular Function

GO:0050661 NADP binding Molecular Function

KEGG gene cross-reference

ath:AT4G20960

ecj:JW0404

eco:b0414

ecoc:C3026_02020

hin:HI_0944

syn:slr0066

zma:100191772

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.242

Rank 1 · LXL04_008914 · OH-1004

Mitochondrion0.216

Rank 2 · LXL04_008914 · OH-1004

Plastid0.213

Rank 3 · LXL04_008914 · OH-1004

Extracellular0.141

Rank 4 · LXL04_008914 · OH-1004

Nucleus0.096

Rank 5 · LXL04_008914 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00383.30dCMP_cyt_deam_141-88 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_008914	`PF00383.30`	dCMP_cyt_deam_1	41	88	9.3e-06	26.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GWP5`	Arabidopsis thaliana	Riboflavin biosynthesis protein PYRD, chloroplastic	78.000%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card