TkA03G297790 | RubberDandelionOmics

Gene overview

TkA03G297790

Reference: TK1151 Chr: Chr03 Coordinates: 73278045-73278554 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

510 bp · TkA03G297790|TK1151|cDNA

ATGTTTACCGAAATCCGATTTAAAAGCATCCTCTGGTTCCGAGTCTATGTACCTACCCAATTCGCCAGCGAAGATCTTCCGGTGATGGTATTCTTTCACGGAGGCAGATTTGTCTTCGCGTCCCCGGATTCAACTCCTTACGACGCTGTGTGCTGTCGGTTCGTGAGAAAAGTTCAGGCCGTCATCTGTGAACTACCGACTCCTTACGAACCTCTGTTTTACTTGGATTTATCAAACTATTCATTATCGGGAGAGATTCC...

CDS

Download CDS FASTA

510 bp · TkA03G297790|TK1151|CDS

ATGTTTACCGAAATCCGATTTAAAAGCATCCTCTGGTTCCGAGTCTATGTACCTACCCAATTCGCCAGCGAAGATCTTCCGGTGATGGTATTCTTTCACGGAGGCAGATTTGTCTTCGCGTCCCCGGATTCAACTCCTTACGACGCTGTGTGCTGTCGGTTCGTGAGAAAAGTTCAGGCCGTCATCTGTGAACTACCGACTCCTTACGAACCTCTGTTTTACTTGGATTTATCAAACTATTCATTATCGGGAGAGATTCC...

Protein

Download Protein FASTA

169 aa · TkA03G297790|TK1151|PROTEIN

MFTEIRFKSILWFRVYVPTQFASEDLPVMVFFHGGRFVFASPDSTPYDAVCCRFVRKVQAVICELPTPYEPLFYLDLSNYSLSGEIPKSLTQLPSLISRGRSQLSQRVGPLRRSISNIFKFKLRETSVYVGVRFLFVIPEQFMYRRLKYQRKISGKLLVWRSGCCFFLL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G297790`
TK1151 ID	TkA03G297790
OH-1004 ID	LXL04_028252
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	88.500
Protein coverage (%)	TK1151 30.769 / OH-1004 15.116 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G297790`
Location	Chr03:73278045-73278554 (+)
Description	Similar to CXE18: Probable carboxylesterase 18
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_028252` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009739 response to gibberellin Biological Process GO:0009740 gibberellic acid mediated signaling pathway Biological Process GO:0009860 pollen tube growth Biological Process GO:0009939 positive regulation of gibberellic acid mediated signaling pathway Biological Process GO:0010476 gibberellin mediated signaling pathway Biological Process GO:0010629 negative regulation of gene expression Biological Process GO:0048444 floral organ morphogenesis Biological Process GO:0048530 fruit morphogenesis Biological Process GO:0071456 cellular response to hypoxia Biological Process GO:1905516 positive regulation of fertilization Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component
KEGG gene cross-reference	ath:AT3G05120 ath:AT3G63010 ath:AT5G23530 ath:AT5G27320 dosa:Os05g0407500 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.305

Rank 1 · TkA03G297790 · TK1151

Nucleus0.264

Rank 2 · TkA03G297790 · TK1151

Endoplasmic reticulum0.214

Rank 3 · TkA03G297790 · TK1151

Cell membrane0.104

Rank 4 · TkA03G297790 · TK1151

Mitochondrion0.102

Rank 5 · TkA03G297790 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10340Say1_Mug1808-40 aa

PF00135COesterase13-48 aa

PF16180RelB_leu_zip23-31 aa

PF07859Abhydrolase_329-63 aa

PF00560LRR_172-93 aa

PF16180RelB_leu_zip74-110 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G297790	`PF10340`	Say1_Mug180	8	40	0.064	12.8
TkA03G297790	`PF00135`	COesterase	13	48	0.00048	19.9
TkA03G297790	`PF16180`	RelB_leu_zip	23	31	0.16	12.7
TkA03G297790	`PF07859`	Abhydrolase_3	29	63	0.0022	18.5
TkA03G297790	`PF00560`	LRR_1	72	93	0.16	12.9
TkA03G297790	`PF16180`	RelB_leu_zip	74	110	0.16	12.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card