LXL04_028252 | RubberDandelionOmics

Gene overview

LXL04_028252

Reference: OH-1004 Chr: Chr06 Coordinates: 35889041-35890153 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1035 bp · LXL04_028252|LXL04_028252|OH1004|cDNA

ATGTCGATGGAGGCCACTGCTAATTCCCCACAGCCGTCACTCTCCTTACCATGGAGAACACGCATTAGTATTTTCCTCCTCTCCACTATCACCGACGCATCTTGCCGGAAAAACGGCACCGTCAACCGTCGTATTGTCACCTTAGTCGACTTCAAGAGCCCGCCGAAGTCAAAATCAGTCAACGGCGTATCCTCACACGATGTCGTTATAGATCAAACTCGTAACCTCTGGTTCCGAGTCTATGTACCTACCCAACTCGC...

CDS

Download CDS FASTA

1035 bp · LXL04_028252|LXL04_028252|OH1004|CDS

ATGTCGATGGAGGCCACTGCTAATTCCCCACAGCCGTCACTCTCCTTACCATGGAGAACACGCATTAGTATTTTCCTCCTCTCCACTATCACCGACGCATCTTGCCGGAAAAACGGCACCGTCAACCGTCGTATTGTCACCTTAGTCGACTTCAAGAGCCCGCCGAAGTCAAAATCAGTCAACGGCGTATCCTCACACGATGTCGTTATAGATCAAACTCGTAACCTCTGGTTCCGAGTCTATGTACCTACCCAACTCGC...

Protein

Download Protein FASTA

344 aa · LXL04_028252|LXL04_028252|OH1004|PROTEIN

MSMEATANSPQPSLSLPWRTRISIFLLSTITDASCRKNGTVNRRIVTLVDFKSPPKSKSVNGVSSHDVVIDQTRNLWFRVYVPTQLANEDLPVMVFFHGGGFVFASPDSTPYDAVCCRFATKVQAVVVSVNYRLAPEHRYPAQHDDCFDVLKFLDDEDNRSTSLQENANLLRCFLAGDSAGANLAHHVAQRACEFNFRRLKVIGVVAIQPFFGGEERTESETRLEGAPLVSIKRTDWMWKAFLPEGEGFNRDHPIINVTG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_028252`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_028252

Location Chr06:35889041-35890153 (+)

Description Similar to CXE18: Probable carboxylesterase 18

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g23530`	Carboxylesterase acting on esters with varying acyl chain length.	No verified direct reference in this release
`At5g27320`	Functions as a soluble gibberellin (GA) receptor.	Identification and characterization of Arabidopsis gibberellin receptors.2006 · DOI: 10.1111/j.1365-313x.2006.02748.x Genetic characterization and functional analysis of the GID1 gibberellin receptors in Arabidopsis.2006 · DOI: 10.1105/tpc.106.047415 Multiple loss-of-function of Arabidopsis gibberellin receptor AtGID1s completely shuts down a gibberellin signal.2007 · DOI: 10.1111/j.1365-313x.2007.03098.x
`At3g63010`	Functions as a soluble gibberellin (GA) receptor.	Identification and characterization of Arabidopsis gibberellin receptors.2006 · DOI: 10.1111/j.1365-313x.2006.02748.x Genetic characterization and functional analysis of the GID1 gibberellin receptors in Arabidopsis.2006 · DOI: 10.1105/tpc.106.047415 Multiple loss-of-function of Arabidopsis gibberellin receptor AtGID1s completely shuts down a gibberellin signal.2007 · DOI: 10.1111/j.1365-313x.2007.03098.x
`At3g05120`	Functions as a soluble gibberellin (GA) receptor.	Identification and characterization of Arabidopsis gibberellin receptors.2006 · DOI: 10.1111/j.1365-313x.2006.02748.x Genetic characterization and functional analysis of the GID1 gibberellin receptors in Arabidopsis.2006 · DOI: 10.1105/tpc.106.047415 Multiple loss-of-function of Arabidopsis gibberellin receptor AtGID1s completely shuts down a gibberellin signal.2007 · DOI: 10.1111/j.1365-313x.2007.03098.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0407500`	Functions as a soluble gibberellin (GA) receptor.	GIBBERELLIN INSENSITIVE DWARF1 encodes a soluble receptor for gibberellin.2005 · DOI: 10.1038/nature04028

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028252 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009739 response to gibberellin Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0009939 positive regulation of gibberellic acid mediated signaling pathway Biological Process

GO:0010476 gibberellin mediated signaling pathway Biological Process

GO:0010629 negative regulation of gene expression Biological Process

GO:0048444 floral organ morphogenesis Biological Process

GO:0048530 fruit morphogenesis Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:1905516 positive regulation of fertilization Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT3G05120

ath:AT3G63010

ath:AT5G23530

ath:AT5G27320

dosa:Os05g0407500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.535

Rank 1 · LXL04_028252 · OH-1004

Nucleus0.192

Rank 2 · LXL04_028252 · OH-1004

Endoplasmic reticulum0.161

Rank 3 · LXL04_028252 · OH-1004

Cell membrane0.084

Rank 4 · LXL04_028252 · OH-1004

Peroxisome0.072

Rank 5 · LXL04_028252 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00135.35COesterase76-135 aa

PF20434.6BD-FAE80-189 aa

PF07859.20Abhydrolase_394-315 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_028252	`PF00135.35`	COesterase	76	135	4.6e-10	39.8
LXL04_028252	`PF20434.6`	BD-FAE	80	189	3.2e-13	50.4
LXL04_028252	`PF07859.20`	Abhydrolase_3	94	315	2.5e-60	204.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LT10`	Arabidopsis thaliana	Probable carboxylesterase 18	58.859%	Swiss-Prot	strong database homology
`Q940G6`	Arabidopsis thaliana	Gibberellin receptor GID1C	42.994%	Swiss-Prot	moderate database homology
`Q9LYC1`	Arabidopsis thaliana	Gibberellin receptor GID1B	38.679%	Swiss-Prot	moderate database homology
`Q9MAA7`	Arabidopsis thaliana	Gibberellin receptor GID1A	36.286%	Swiss-Prot	moderate database homology
`Q6L545`	Oryza sativa subsp. japonica	Gibberellin receptor GID1	36.335%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card