TkA03G239440 | RubberDandelionOmics

Gene overview

TkA03G239440

Reference: TK1151 Chr: Chr03 Coordinates: 59628832-59629656 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

552 bp · TkA03G239440|TK1151|cDNA

ATGGGAATAGCTCTTCCATCATTTCTGCTAAACATAGAAGTTGCATCTGGTGGGATTGTATTACGATGGATTGTTGGGGTTTGCTTATCTTTCAAGATCTTCAAAGTATACTGGAAACTCAAGAATATCAAACAAGAACATGCAAAGTTTTGGAAGCAACATCCCGCATTAGTAAAGGCTCATTTGACCCCAGAATTACAGCATGACTTTAAACGCGTAGTGGAGCTTGCATCTCGCCTTCTTCAAGAGTTAATGAAGGC...

CDS

Download CDS FASTA

552 bp · TkA03G239440|TK1151|CDS

ATGGGAATAGCTCTTCCATCATTTCTGCTAAACATAGAAGTTGCATCTGGTGGGATTGTATTACGATGGATTGTTGGGGTTTGCTTATCTTTCAAGATCTTCAAAGTATACTGGAAACTCAAGAATATCAAACAAGAACATGCAAAGTTTTGGAAGCAACATCCCGCATTAGTAAAGGCTCATTTGACCCCAGAATTACAGCATGACTTTAAACGCGTAGTGGAGCTTGCATCTCGCCTTCTTCAAGAGTTAATGAAGGC...

Protein

Download Protein FASTA

183 aa · TkA03G239440|TK1151|PROTEIN

MGIALPSFLLNIEVASGGIVLRWIVGVCLSFKIFKVYWKLKNIKQEHAKFWKQHPALVKAHLTPELQHDFKRVVELASRLLQELMKARVLDPADYTGLEAALDNHKVSLYFTESPTNPFLRCVDIELVSKMCHEKGAIVCIDGTFATPLNQKALALGVDIVFYSATKYIGGHNDTAIYFFYYS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G239440`
TK1151 ID	TkA03G239440
OH-1004 ID	LXL04_007919
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	98.400
Protein coverage (%)	TK1151 100.000 / OH-1004 69.057 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G239440

Location Chr03:59628832-59629656 (-)

Description Similar to CGS1: Cystathionine gamma-synthase 1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g01120`	Catalyzes the first committed step of methionine (Met) biosynthesis.	No verified direct reference in this release
`At1g33320`	Catalyzes the first committed step of methionine (Met) biosynthesis.	No verified direct reference in this release
`At1g79940`	Required for integral membrane and secreted preprotein translocation across the endoplasmic reticulum membrane.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007919 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0001887 selenium compound metabolic process Biological Process

GO:0009086 methionine biosynthetic process Biological Process

GO:0019343 L-cysteine biosynthetic process via L-cystathionine Biological Process

GO:0019346 transsulfuration Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0003962 cystathionine gamma-synthase activity Molecular Function

GO:0004123 cystathionine gamma-lyase activity Molecular Function

GO:0016846 carbon-sulfur lyase activity Molecular Function

GO:0030170 pyridoxal phosphate binding Molecular Function

GO:0047804 cysteine-S-conjugate beta-lyase activity Molecular Function

KEGG gene cross-reference

ath:AT1G33320

ath:AT3G01120

bsu:BSU11870

llm:llmg_1776

nta:107822634

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.267

Rank 1 · TkA03G239440 · TK1151

Cytoplasm0.202

Rank 2 · TkA03G239440 · TK1151

Peroxisome0.153

Rank 3 · TkA03G239440 · TK1151

Mitochondrion0.140

Rank 4 · TkA03G239440 · TK1151

Extracellular0.089

Rank 5 · TkA03G239440 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03708Avian_gp8523-60 aa

PF01053Cys_Met_Meta_PP82-175 aa

PF00266Aminotran_5121-170 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G239440	`PF03708`	Avian_gp85	23	60	0.1	12.5
TkA03G239440	`PF01053`	Cys_Met_Meta_PP	82	175	6.6e-30	104.6
TkA03G239440	`PF00266`	Aminotran_5	121	170	0.0029	17.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P55217`	Arabidopsis thaliana	sp\|P55217\|CGS1_ARATH Cystathionine gamma-synthase 1, chloroplastic	80.200%	Swiss-Prot	Low
`Q9C876`	Arabidopsis thaliana	sp\|Q9C876\|CGS2_ARATH Probable cystathionine gamma-synthase 2	69.400%	Swiss-Prot	Low
`Q0WT48`	Arabidopsis thaliana	sp\|Q0WT48\|DNJ21_ARATH DnaJ protein ERDJ2A	34.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card