Gene Card
Gene overview
cDNA / CDS / Protein Sequences
907 bp · LXL04_007919|LXL04_007919|OH1004|cDNA
ATGTCGTCGTCGCAGCTGTTGGAATGCCTTGTGCTTAACCTTTGTGATCATCCTTGCTGGTCCTATTGCCAAGGGTTTTCTGACATGGTTTTATTAATGGACAACATGGTTGATATGCTTTCTGATGTTAAGCTTCAGCCAACTAAGATCCTGACCGCTATATGTGGCCTGTTGCATACATTAAAATCAAACAAAGGTACAAAAGAAAAGAATCTCAGTCATTCTATATCTGAACAGGGGTTTGAAATGGGAATAGCTCT...
798 bp · LXL04_007919|LXL04_007919|OH1004|CDS
ATGTCGTCGTCGCAGCTGTTGGAATGCCTTGTGCTTAACCTTTGTGATCATCCTTGCTGGTCCTATTGCCAAGGGTTTTCTGACATGGTTTTATTAATGGACAACATGGTTGATATGCTTTCTGATGTTAAGCTTCAGCCAACTAAGATCCTGACCGCTATATGTGGCCTGTTGCATACATTAAAATCAAACAAAGGTACAAAAGAAAAGAATCTCAGTCATTCTATATCTGAACAGGGGTTTGAAATGGGAATAGCTCT...
Protein
Download Protein FASTA265 aa · LXL04_007919|LXL04_007919|OH1004|PROTEIN
MSSSQLLECLVLNLCDHPCWSYCQGFSDMVLLMDNMVDMLSDVKLQPTKILTAICGLLHTLKSNKGTKEKNLSHSISEQGFEMGIALPSFLLNIEVASGGIVLRWIVGVCLSFKIFKVYWKLKNIKQEHAKFWKQHPALVKAHLTPELQHDFKRVVELASCLLQELMKATVLDPADYTGLEAALDNHKVSLYFTESPTNPFLRCVDIELVSKMCHEKGAIVCIDGTFATPLNQKALALGADIVFYSATKYIGGHNDTAIY...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_007919 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_007919 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:74651326-74654689 (-) | |||||||||
| Description | Similar to CGS1: Cystathionine gamma-synthase 1, chloroplastic | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0001887 selenium compound metabolic process Biological Process GO:0009086 methionine biosynthetic process Biological Process GO:0019343 L-cysteine biosynthetic process via L-cystathionine Biological Process GO:0019346 transsulfuration Biological Process GO:0005737 cytoplasm Cellular Component GO:0009507 chloroplast Cellular Component GO:0009570 chloroplast stroma Cellular Component GO:0003962 cystathionine gamma-synthase activity Molecular Function GO:0004123 cystathionine gamma-lyase activity Molecular Function GO:0016846 carbon-sulfur lyase activity Molecular Function GO:0030170 pyridoxal phosphate binding Molecular Function GO:0047804 cysteine-S-conjugate beta-lyase activity Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT1G33320 ath:AT3G01120 bsu:BSU11870 llm:llmg_1776 nta:107822634 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF01053.27Cys_Met_Meta_PP166-257 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_007919 | PF01053.27 | Cys_Met_Meta_PP | 166 | 257 | 7.7e-30 | 104.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.