TkA03G238670 | RubberDandelionOmics

Gene overview

TkA03G238670

Reference: TK1151 Chr: Chr03 Coordinates: 59379193-59380313 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

711 bp · TkA03G238670|TK1151|cDNA

TCCTCCGACACAATCGACAATGTGAAGGCCAAGATCCAAGACAAGGAAGGCATCCCACCGGACCAGCAACGTCTTATTTTCGCCGGTAAGCAGCTTGAGGAAGGCCGAACTCTCGCCGACTACAACATCCAGAAGGAGCCAACTCTCCACCTGGTTCTCCGTCTTCGTGGAGGCGCGAAGAAGCGCATGAAGAAGACGTACACGAAACCGAAGAAGATCAAGCATAAGCACAAGAAGGTGAAGTTGAGTGTGTTGCAGTT...

CDS

Download CDS FASTA

711 bp · TkA03G238670|TK1151|CDS

TCCTCCGACACAATCGACAATGTGAAGGCCAAGATCCAAGACAAGGAAGGCATCCCACCGGACCAGCAACGTCTTATTTTCGCCGGTAAGCAGCTTGAGGAAGGCCGAACTCTCGCCGACTACAACATCCAGAAGGAGCCAACTCTCCACCTGGTTCTCCGTCTTCGTGGAGGCGCGAAGAAGCGCATGAAGAAGACGTACACGAAACCGAAGAAGATCAAGCATAAGCACAAGAAGGTGAAGTTGAGTGTGTTGCAGTT...

Protein

Download Protein FASTA

236 aa · TkA03G238670|TK1151|PROTEIN

SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEEGRTLADYNIQKEPTLHLVLRLRGGAKKRMKKTYTKPKKIKHKHKKVKLSVLQFYKVNDSVEERGGGRGEDPNGNNQDGSQSTAVSASPICPRTQLHTVNTATRRSDSQRHAAPTSPPVTSPPPTSARVLRSPLIVEQSASHTATHSEHNDTQSPPCSAIASLLRRPLPAPTSPPCSAPLSRRTTTGSSAHDLKFSAPPSDFR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G238670`
TK1151 ID	TkA03G238670
OH-1004 ID	LXL04_007909
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	92.800
Protein coverage (%)	TK1151 100.000 / OH-1004 74.194 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G238670

Location Chr03:59379193-59380313 (+)

Description Similar to RPS27AA: Ubiquitin-40S ribosomal protein S27a-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g23410`	Ubiquitin exists either covalently attached to another protein, or free (unanchored).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007909 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006412 translation Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0019941 modification-dependent protein catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005840 ribosome Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009536 plastid Cellular Component

GO:0022626 cytosolic ribosome Cellular Component

GO:0022627 cytosolic small ribosomal subunit Cellular Component

KEGG gene cross-reference

ath:AT1G23410

dosa:Os01g0328400

kla:KLLA0_D18304g

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.491

Rank 1 · TkA03G238670 · TK1151

Cytoplasm0.423

Rank 2 · TkA03G238670 · TK1151

Cell membrane0.092

Rank 3 · TkA03G238670 · TK1151

Extracellular0.082

Rank 4 · TkA03G238670 · TK1151

Mitochondrion0.079

Rank 5 · TkA03G238670 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00240ubiquitin1-56 aa

PF14560Ubiquitin_22-40 aa

PF11976Rad60-SLD3-53 aa

PF13881Rad60-SLD_222-73 aa

PF11976Rad60-SLD62-82 aa

PF14560Ubiquitin_282-93 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G238670	`PF00240`	ubiquitin	1	56	4e-22	78.5
TkA03G238670	`PF14560`	Ubiquitin_2	2	40	0.011	16.9
TkA03G238670	`PF11976`	Rad60-SLD	3	53	2.4e-10	40.7
TkA03G238670	`PF13881`	Rad60-SLD_2	22	73	0.053	14.4
TkA03G238670	`PF11976`	Rad60-SLD	62	82	2.4e-10	40.7
TkA03G238670	`PF14560`	Ubiquitin_2	82	93	0.011	16.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P59271`	Arabidopsis thaliana	sp\|P59271\|R27AA_ARATH Ubiquitin-ribosomal protein eS31z fusion protein	92.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card