LXL04_007909 | RubberDandelionOmics

Gene overview

LXL04_007909

Reference: OH-1004 Chr: Chr02 Coordinates: 74084239-74086580 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

933 bp · LXL04_007909|LXL04_007909|OH1004|cDNA

ATGGAGATCATGCAAACCCCACGCGCCAAAGATCCCACGTACATCTCAGCAGCACCAGTCAGCACCAAGGAATCCGAAACAACAGCAGCTCCTTCtgaagtctcagcgtctcccgaagtctcagcgtctccggaagtctcagcgtctcccgaagtctcagcgtctaTCTCCGAATCAGCGACCAAGTATTCCGAAGCTGGTTTTTCCGAAGTTAACCCGCCCATATTCTTATCAGCACTATCCTCCGACACAATCGACAA...

CDS

Download CDS FASTA

933 bp · LXL04_007909|LXL04_007909|OH1004|CDS

ATGGAGATCATGCAAACCCCACGCGCCAAAGATCCCACGTACATCTCAGCAGCACCAGTCAGCACCAAGGAATCCGAAACAACAGCAGCTCCTTCTGAAGTCTCAGCGTCTCCCGAAGTCTCAGCGTCTCCGGAAGTCTCAGCGTCTCCCGAAGTCTCAGCGTCTATCTCCGAATCAGCGACCAAGTATTCCGAAGCTGGTTTTTCCGAAGTTAACCCGCCCATATTCTTATCAGCACTATCCTCCGACACAATCGACAA...

Protein

Download Protein FASTA

310 aa · LXL04_007909|LXL04_007909|OH1004|PROTEIN

MEIMQTPRAKDPTYISAAPVSTKESETTAAPSEVSASPEVSASPEVSASPEVSASISESATKYSEAGFSEVNPPIFLSALSSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEEGRTLADYNIQKEPTLHLVLRLRGGAKKRMKKTYTKPKKIKHKHKKVKLSVLQFYKVDDSVEERGEVEERIQTGTTKTVSASPICPRTQLHTVNTATRRSDSQRHAAPTSPPVTSPPPTSARVLRSPLIVEQSASHTATHSEHNDTQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_007909`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_007909

Location Chr02:74084239-74086580 (+)

Description Similar to RPS27AA: Ubiquitin-40S ribosomal protein S27a-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g23410`	Ubiquitin exists either covalently attached to another protein, or free (unanchored).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0328400`	Exists either covalently attached to another protein, or free (unanchored).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007909 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006412 translation Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0019941 modification-dependent protein catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005840 ribosome Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009536 plastid Cellular Component

GO:0022626 cytosolic ribosome Cellular Component

GO:0022627 cytosolic small ribosomal subunit Cellular Component

KEGG gene cross-reference

ath:AT1G23410

dosa:Os01g0328400

kla:KLLA0_D18304g

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.501

Rank 1 · LXL04_007909 · OH-1004

Cytoplasm0.430

Rank 2 · LXL04_007909 · OH-1004

Cell membrane0.091

Rank 3 · LXL04_007909 · OH-1004

Mitochondrion0.079

Rank 4 · LXL04_007909 · OH-1004

Endoplasmic reticulum0.060

Rank 5 · LXL04_007909 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00240.30ubiquitin76-136 aa

PF11976.15Rad60-SLD76-133 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_007909	`PF00240.30`	ubiquitin	76	136	9.3e-23	80.5
LXL04_007909	`PF11976.15`	Rad60-SLD	76	133	8.2e-11	42.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P59271`	Arabidopsis thaliana	Ubiquitin-ribosomal protein eS31z fusion protein	89.899%	Swiss-Prot	weak database homology
`Q9ARZ9`	Oryza sativa subsp. japonica	Ubiquitin-ribosomal protein eS31z fusion protein	89.899%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card