TkA03G199870 | RubberDandelionOmics

Gene overview

TkA03G199870

Reference: TK1151 Chr: Chr03 Coordinates: 50113906-50119091 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2798 bp · TkA03G199870|TK1151|cDNA

AATGCAACAAATTTGTTGTTTACTAATTTATCTGCGTAAACAACTCCGCCGTCTCTTTCTATCTCACAAGTCACAACAACATTGTAACGTAACGTCGGACAAGAATACATTAACAAAATTCTCAAGAATAGATCGAGTGGAAGACATGGTTTGGTTTGGATGTTGGATTGCACTACTAGTGTTCACGGTGGAGGTGGGGGGAGCAACCGTGAGTTATGACGGAAGATCACTTATTATTGATGGACAGCGCACAATATTGT...

CDS

Download CDS FASTA

2553 bp · TkA03G199870|TK1151|CDS

ATGCAACAAATTTGTTGTTTACTAATTTATCTGCGTAAACAACTCCGCCGTCTCTTTCTATCTCACAAGTCACAACAACATTGTAACGTAACGTCGGACAAGAATACATTAACAAAATTCTCAAGAATAGATCGAGTGGAAGACATGGTTTGGTTTGGATGTTGGATTGCACTACTAGTGTTCACGGTGGAGGTGGGGGGAGCAACCGTGAGTTATGACGGAAGATCACTTATTATTGATGGACAGCGCACAATATTGTT...

Protein

Download Protein FASTA

850 aa · TkA03G199870|TK1151|PROTEIN

MQQICCLLIYLRKQLRRLFLSHKSQQHCNVTSDKNTLTKFSRIDRVEDMVWFGCWIALLVFTVEVGGATVSYDGRSLIIDGQRTILFSGSIHYARSTPDMWPSLIAKAKKGGLDVIQTYVFWNLHEPQPGQYDFSGRNDIISFIKQVQQQGLYVSLRIGPFIEAEWTYGGLPFWLHDVPGIVFRTNNEPFKLHMQNFTTKIVNMMKAENLFASQGGPIILSQIENEYQNVEGSFHDDGRQYVNWTATMAVSQNTNEPWMM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G199870`
TK1151 ID	TkA03G199870
OH-1004 ID	LXL04_007628
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	96.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G199870

Location Chr03:50113906-50119091 (-)

Description Similar to BGAL16: Beta-galactosidase 16

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g77410`	Beta-galactosidase 16.	No verified direct reference in this release
`At5g63800`	Beta-galactosidase 6.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0428100`	Beta-galactosidase 7.	No verified direct reference in this release
`Os01g0580200`	Beta-galactosidase 2.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007628 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009827 plant-type cell wall modification Biological Process

GO:0019388 galactose catabolic process Biological Process

GO:0048354 mucilage biosynthetic process involved in seed coat development Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005773 vacuole Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009536 plastid Cellular Component

GO:0048046 apoplast Cellular Component

GO:0004565 beta-galactosidase activity Molecular Function

GO:0030246 carbohydrate binding Molecular Function

KEGG gene cross-reference

ath:AT1G77410

ath:AT5G63800

dosa:Os01g0580200

dosa:Os08g0549200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.371

Rank 1 · TkA03G199870 · TK1151

Extracellular0.249

Rank 2 · TkA03G199870 · TK1151

Cytoplasm0.175

Rank 3 · TkA03G199870 · TK1151

Endoplasmic reticulum0.159

Rank 4 · TkA03G199870 · TK1151

Cell membrane0.154

Rank 5 · TkA03G199870 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01301Glyco_hydro_3576-383 aa

PF02449Glyco_hydro_4299-230 aa

PF02140SUEL_Lectin260-277 aa

PF17834GHD407-462 aa

PF21944Hemotin427-462 aa

PF13385Laminin_G_3506-563 aa

PF13364BetaGal_ABD2510-582 aa

PF21467BetaGal_gal-bd516-555 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G199870	`PF01301`	Glyco_hydro_35	76	383	2.8e-111	372.9
TkA03G199870	`PF02449`	Glyco_hydro_42	99	230	1.5e-05	25.2
TkA03G199870	`PF02140`	SUEL_Lectin	260	277	1e-19	71.4
TkA03G199870	`PF17834`	GHD	407	462	8.4e-24	83.8
TkA03G199870	`PF21944`	Hemotin	427	462	0.24	11.9
TkA03G199870	`PF13385`	Laminin_G_3	506	563	0.0055	17.6
TkA03G199870	`PF13364`	BetaGal_ABD2	510	582	3.2e-07	31.8
TkA03G199870	`PF21467`	BetaGal_gal-bd	516	555	1.6e-25	89.7
TkA03G199870	`PF13385`	Laminin_G_3	640	706	0.0055	17.6
TkA03G199870	`PF13364`	BetaGal_ABD2	643	718	3.2e-07	31.8
TkA03G199870	`PF21467`	BetaGal_gal-bd	650	716	1.6e-25	89.7
TkA03G199870	`PF02140`	SUEL_Lectin	772	849	1e-19	71.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GX69`	Arabidopsis thaliana	sp\|Q8GX69\|BGA16_ARATH Beta-galactosidase 16	59.300%	Swiss-Prot	High
`Q9FFN4`	Arabidopsis thaliana	sp\|Q9FFN4\|BGAL6_ARATH Beta-galactosidase 6	58.700%	Swiss-Prot	High
`Q75HQ3`	Oryza sativa subsp. japonica	sp\|Q75HQ3\|BGAL7_ORYSJ Beta-galactosidase 7	51.700%	Swiss-Prot	High
`Q8W0A1`	Oryza sativa subsp. japonica	sp\|Q8W0A1\|BGAL2_ORYSJ Beta-galactosidase 2	48.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card