LXL04_007628 | RubberDandelionOmics

Gene overview

LXL04_007628

Reference: OH-1004 Chr: Chr02 Coordinates: 54754614-54759648 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2622 bp · LXL04_007628|LXL04_007628|OH1004|cDNA

ATGcaacaaatttgttgtttacTAATTTATCTGCTTAAACAACTCCGCCGTCTCTTTCTATCTCACAAGTCACAACAACATTGTAACGTAACGTCGGACAAGATTACATTAACAAAATTCTCAAGAATGTATACATATggttatgtatatatatgtaaagTCCAACAAGAATGCTCTAACAATTTACTCCCTTCTCTAGATCGAGTGGAAGACATGGTTTGGTTTGGATGTTGGattgcactactagtgttcaCGGTGGA...

CDS

Download CDS FASTA

2622 bp · LXL04_007628|LXL04_007628|OH1004|CDS

ATGCAACAAATTTGTTGTTTACTAATTTATCTGCTTAAACAACTCCGCCGTCTCTTTCTATCTCACAAGTCACAACAACATTGTAACGTAACGTCGGACAAGATTACATTAACAAAATTCTCAAGAATGTATACATATGGTTATGTATATATATGTAAAGTCCAACAAGAATGCTCTAACAATTTACTCCCTTCTCTAGATCGAGTGGAAGACATGGTTTGGTTTGGATGTTGGATTGCACTACTAGTGTTCACGGTGGA...

Protein

Download Protein FASTA

873 aa · LXL04_007628|LXL04_007628|OH1004|PROTEIN

MQQICCLLIYLLKQLRRLFLSHKSQQHCNVTSDKITLTKFSRMYTYGYVYICKVQQECSNNLLPSLDRVEDMVWFGCWIALLVFTVEVGGATVSYDGRSLIIDGQRTILFSGSIHYARSTPDMWPSLIAKAKKGGLDVIQTYVFWNLHEPQPGQYDFSGRNDIISFIKQVQQQGLYVSLRIGPFIEAEWTYGGLPFWLHDVPGIVFRTNNEPFKLHMQNFTTKIVNMMKAENLFASQGGPIILSQIENEYQNVEGSFHDD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_007628`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_007628

Location Chr02:54754614-54759648 (-)

Description Similar to BGAL16: Beta-galactosidase 16

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g77410`	Beta-galactosidase 16.	No verified direct reference in this release
`At5g63800`	Beta-galactosidase 6.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0428100`	Beta-galactosidase 7.	No verified direct reference in this release
`Os08g0549200`	Beta-galactosidase 11.	No verified direct reference in this release
`Os01g0580200`	Beta-galactosidase 2.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007628 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009827 plant-type cell wall modification Biological Process

GO:0019388 galactose catabolic process Biological Process

GO:0048354 mucilage biosynthetic process involved in seed coat development Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005773 vacuole Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009536 plastid Cellular Component

GO:0048046 apoplast Cellular Component

GO:0004565 beta-galactosidase activity Molecular Function

GO:0030246 carbohydrate binding Molecular Function

KEGG gene cross-reference

ath:AT1G77410

ath:AT5G63800

dosa:Os01g0580200

dosa:Os08g0549200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.388

Rank 1 · LXL04_007628 · OH-1004

Extracellular0.226

Rank 2 · LXL04_007628 · OH-1004

Cytoplasm0.180

Rank 3 · LXL04_007628 · OH-1004

Endoplasmic reticulum0.164

Rank 4 · LXL04_007628 · OH-1004

Cell membrane0.158

Rank 5 · LXL04_007628 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01301.26Glyco_hydro_3599-406 aa

PF17834.8GHD430-485 aa

PF13364.13BetaGal_ABD2666-741 aa

PF21467.4BetaGal_gal-bd673-739 aa

PF02140.24SUEL_Lectin795-872 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_007628	`PF01301.26`	Glyco_hydro_35	99	406	2.5e-111	373.0
LXL04_007628	`PF17834.8`	GHD	430	485	8.7e-24	83.7
LXL04_007628	`PF13364.13`	BetaGal_ABD2	666	741	5e-07	31.2
LXL04_007628	`PF21467.4`	BetaGal_gal-bd	673	739	1.6e-25	89.7
LXL04_007628	`PF02140.24`	SUEL_Lectin	795	872	1.1e-19	71.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GX69`	Arabidopsis thaliana	Beta-galactosidase 16	59.209%	Swiss-Prot	strong database homology
`Q9FFN4`	Arabidopsis thaliana	Beta-galactosidase 6	58.547%	Swiss-Prot	strong database homology
`Q75HQ3`	Oryza sativa subsp. japonica	Beta-galactosidase 7	51.677%	Swiss-Prot	strong database homology
`Q6ZJJ0`	Oryza sativa subsp. japonica	Beta-galactosidase 11	46.287%	Swiss-Prot	moderate database homology
`Q8W0A1`	Oryza sativa subsp. japonica	Beta-galactosidase 2	48.892%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card