TkA03G192680 | RubberDandelionOmics

Gene overview

TkA03G192680

Reference: TK1151 Chr: Chr03 Coordinates: 48482145-48485897 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3666 bp · TkA03G192680|TK1151|cDNA

TCTCTCTAAAACTATTGGCTTCCTGCAAACTGTAATCATGGAAGTCGATCACTTATTATTAACCACGTGATAACCAAGAACACCCACCCGAATTGTAAAGAACACCCTGAAGATGATGAAAGCTCATAGCTTTAACAAATTTGCTTTTGTTCTTATCTTGTTTCTCTCTCTAGTGTCTGTTCATGGTGACGTCGATGAATCTCACCAGCTCTTATCGTTTAAATCTTCTCTTAAAAAGCCAAATATATTGACAGATTGGT...

CDS

Download CDS FASTA

3444 bp · TkA03G192680|TK1151|CDS

ATGATGAAAGCTCATAGCTTTAACAAATTTGCTTTTGTTCTTATCTTGTTTCTCTCTCTAGTGTCTGTTCATGGTGACGTCGATGAATCTCACCAGCTCTTATCGTTTAAATCTTCTCTTAAAAAGCCAAATATATTGACAGATTGGTTGGCTGGGAACCACCCGTGTAATTTTAGTGGTGTTTTTTGTAAAGACTTTAAAGTTTCGTCTATAGATCTCAGTGGTAATGATTTGAGCTCCGATTTCCGCTCGAGATCTCA...

Protein

Download Protein FASTA

1147 aa · TkA03G192680|TK1151|PROTEIN

MMKAHSFNKFAFVLILFLSLVSVHGDVDESHQLLSFKSSLKKPNILTDWLAGNHPCNFSGVFCKDFKVSSIDLSGNDLSSDFRSRSQCSRALVVVDLAENGVSGSFHDASTFTACPKLNTLNLSRNSIDFNGGLKPIGISVEVIDLSYNRISWGKPNVVQWILSNGCRELRHLSVKGNKIAGDLPEFDCPNLEYIDLSANNFSSGFPSFHDCSSLEYLDLSSNKFSGDISGALASCKRLSFLNLTQNQFAGEIPSFPVDS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G192680`
TK1151 ID	TkA03G192680
OH-1004 ID	LXL04_007580
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G192680

Location Chr03:48482145-48485897 (+)

Description Similar to Systemin receptor SR160

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g39400`	Receptor with a dual specificity kinase activity acting on both serine/threonine- and tyrosine-containing substrates.	Brassinosteroid-insensitive dwarf mutants of Arabidopsis accumulate brassinosteroids.1999 · DOI: 10.1104/pp.121.3.743 Brassinosteroid-insensitive-1 is a ubiquitously expressed leucine-rich repeat receptor serine/threonine kinase.2000 · DOI: 10.1104/pp.123.4.1247 The Arabidopsis transthyretin-like protein is a potential substrate of BRASSINOSTEROID-INSENSITIVE 1.2004 · DOI: 10.1105/tpc.104.023903 The Arabidopsis thaliana brassinosteroid receptor (AtBRI1) contains a domain that functions as a guanylyl cyclase in vitro.2007 · DOI: 10.1371/journal.pone.0000449 BSKs mediate signal transduction from the receptor kinase BRI1 in Arabidopsis.2008 · DOI: 10.1126/science.1156973 Tyrosine phosphorylation of the BRI1 receptor kinase emerges as a component of brassinosteroid signaling in Arabidopsis.2009 · DOI: 10.1073/pnas.0810249106 BSKs are partially redundant positive regulators of brassinosteroid signaling in Arabidopsis.2013 · DOI: 10.1111/tpj.12175
`At3g13380`	Receptor with a dual specificity kinase activity acting on both serine/threonine- and tyrosine-containing substrates.	BRL1 and BRL3 are novel brassinosteroid receptors that function in vascular differentiation in Arabidopsis.2004 · DOI: 10.1242/dev.01403

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0718300`	Receptor kinase involved in brassinosteroid (BR) signal transduction.	Loss of function of a rice brassinosteroid insensitive1 homolog prevents internode elongation and bending of the lamina joint.2000 · DOI: 10.1105/tpc.12.9.1591 The role of OsBRI1 and its homologous genes, OsBRL1 and OsBRL3, in rice.2006 · DOI: 10.1104/pp.105.072330 OsBRI1 Activates BR Signaling by Preventing Binding between the TPR and Kinase Domains of OsBSK3 via Phosphorylation.2016 · DOI: 10.1104/pp.15.01668 OsREM4.1 Interacts with OsSERK1 to Coordinate the Interlinking between Abscisic Acid and Brassinosteroid Signaling in Rice.2016 · DOI: 10.1016/j.devcel.2016.06.011

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007580 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0001578 microtubule bundle formation Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009647 skotomorphogenesis Biological Process

GO:0009729 detection of brassinosteroid stimulus Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0009755 hormone-mediated signaling pathway Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0009911 positive regulation of flower development Biological Process

GO:0010224 response to UV-B Biological Process

GO:0010268 brassinosteroid homeostasis Biological Process

GO:0010584 pollen exine formation Biological Process

KEGG gene cross-reference

ath:AT3G13380

ath:AT4G39400

dosa:Os01g0718300

sly:101261320

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.869

Rank 1 · TkA03G192680 · TK1151

Endoplasmic reticulum0.088

Rank 2 · TkA03G192680 · TK1151

Cytoplasm0.062

Rank 3 · TkA03G192680 · TK1151

Nucleus0.047

Rank 4 · TkA03G192680 · TK1151

Lysosome / Vacuole0.026

Rank 5 · TkA03G192680 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263LRRNT_229-63 aa

PF20141Island53-62 aa

PF00560LRR_169-80 aa

PF13516LRR_669-80 aa

PF29265LRR_CARMIL69-129 aa

PF13855LRR_870-97 aa

PF12799LRR_470-100 aa

PF00560LRR_192-106 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G192680	`PF08263`	LRRNT_2	29	63	1.8e-07	32.0
TkA03G192680	`PF20141`	Island	53	62	1.3e-30	105.3
TkA03G192680	`PF00560`	LRR_1	69	80	6.6e-57	177.8
TkA03G192680	`PF13516`	LRR_6	69	80	9.2e-14	51.0
TkA03G192680	`PF29265`	LRR_CARMIL	69	129	0.25	10.7
TkA03G192680	`PF13855`	LRR_8	70	97	6.2e-49	164.3
TkA03G192680	`PF12799`	LRR_4	70	100	2.7e-41	139.4
TkA03G192680	`PF00560`	LRR_1	92	106	6.6e-57	177.8
TkA03G192680	`PF12799`	LRR_4	92	129	2.7e-41	139.4
TkA03G192680	`PF13855`	LRR_8	108	150	6.2e-49	164.3
TkA03G192680	`PF13306`	LRR_5	110	126	5.4	7.6
TkA03G192680	`PF24758`	LRR_At5g56370	113	127	4e-05	24.1
TkA03G192680	`PF29477`	COS111_C	114	128	0.04	14.4
TkA03G192680	`PF13516`	LRR_6	115	132	9.2e-14	51.0
TkA03G192680	`PF29460`	LRR_NXF2	116	152	0.33	11.4
TkA03G192680	`PF00560`	LRR_1	117	131	6.6e-57	177.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22476`	Arabidopsis thaliana	sp\|O22476\|BRI1_ARATH Protein BRASSINOSTEROID INSENSITIVE 1	66.900%	Swiss-Prot	High
`Q9LJF3`	Arabidopsis thaliana	sp\|Q9LJF3\|BRL3_ARATH Receptor-like protein kinase BRI1-like 3	52.600%	Swiss-Prot	High
`Q942F3`	Oryza sativa subsp. japonica	sp\|Q942F3\|BRI1_ORYSJ Brassinosteroid LRR receptor kinase BRI1	66.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card