RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_007580
Reference: OH-1004 Chr: Chr02 Coordinates: 52973585-52977115 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3444 bp · LXL04_007580|LXL04_007580|OH1004|cDNA

ATGATGAAAGCTCATAGCTTTAACAAATTTGCTTTTGTTCTTATCTTGTTTCTCTCTCTAGTGTCTGTTCATGGTGACGTCGATGAATCTCACCAGCTCTTATCGTTTAAATCTTCTCTTAAAAAGCCAAATATATTGACAGATTGGTTGGCTGGGATCCACCCGTGTAATTTTAGTGGTGTTTTTTGTAAAGACTCTAAAGTTTCGTCTATAGATCTCAGTGGTAATGATTTGAGCTCCGATTTCCGTTCGAGATCTCA...

CDS

Download CDS FASTA

3444 bp · LXL04_007580|LXL04_007580|OH1004|CDS

ATGATGAAAGCTCATAGCTTTAACAAATTTGCTTTTGTTCTTATCTTGTTTCTCTCTCTAGTGTCTGTTCATGGTGACGTCGATGAATCTCACCAGCTCTTATCGTTTAAATCTTCTCTTAAAAAGCCAAATATATTGACAGATTGGTTGGCTGGGATCCACCCGTGTAATTTTAGTGGTGTTTTTTGTAAAGACTCTAAAGTTTCGTCTATAGATCTCAGTGGTAATGATTTGAGCTCCGATTTCCGTTCGAGATCTCA...

Protein

Download Protein FASTA

1147 aa · LXL04_007580|LXL04_007580|OH1004|PROTEIN

MMKAHSFNKFAFVLILFLSLVSVHGDVDESHQLLSFKSSLKKPNILTDWLAGIHPCNFSGVFCKDSKVSSIDLSGNDLSSDFRSRSQCSRALVVVDLAENGVSGSFHDASTFTACPKLNTLNLSRNSIDFNGGLKPIGISVEVIDLSYNRISWGKPNVVQWILSNGCRELRHLSVKGNKIAGDLPEFDCPNLEYIDLSANNFSSGFPSFHDCSSLEYLDLSSNKFSGDISGALASCKRLSFLNLTQNQFAGEIPSFPVDS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_007580
Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_007580
LocationChr02:52973585-52977115 (+)
DescriptionSimilar to Systemin receptor SR160
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At4g39400 Receptor with a dual specificity kinase activity acting on both serine/threonine- and tyrosine-containing substrates.
Brassinosteroid-insensitive dwarf mutants of Arabidopsis accumulate brassinosteroids.1999 · DOI: 10.1104/pp.121.3.743
Brassinosteroid-insensitive-1 is a ubiquitously expressed leucine-rich repeat receptor serine/threonine kinase.2000 · DOI: 10.1104/pp.123.4.1247
The Arabidopsis transthyretin-like protein is a potential substrate of BRASSINOSTEROID-INSENSITIVE 1.2004 · DOI: 10.1105/tpc.104.023903
The Arabidopsis thaliana brassinosteroid receptor (AtBRI1) contains a domain that functions as a guanylyl cyclase in vitro.2007 · DOI: 10.1371/journal.pone.0000449
BSKs mediate signal transduction from the receptor kinase BRI1 in Arabidopsis.2008 · DOI: 10.1126/science.1156973
Tyrosine phosphorylation of the BRI1 receptor kinase emerges as a component of brassinosteroid signaling in Arabidopsis.2009 · DOI: 10.1073/pnas.0810249106
BSKs are partially redundant positive regulators of brassinosteroid signaling in Arabidopsis.2013 · DOI: 10.1111/tpj.12175
At3g13380 Receptor with a dual specificity kinase activity acting on both serine/threonine- and tyrosine-containing substrates.
BRL1 and BRL3 are novel brassinosteroid receptors that function in vascular differentiation in Arabidopsis.2004 · DOI: 10.1242/dev.01403

Rice

Reference gene IDPossible functionPapers / DOI
Os01g0718300 Receptor kinase involved in brassinosteroid (BR) signal transduction.
Loss of function of a rice brassinosteroid insensitive1 homolog prevents internode elongation and bending of the lamina joint.2000 · DOI: 10.1105/tpc.12.9.1591
The role of OsBRI1 and its homologous genes, OsBRL1 and OsBRL3, in rice.2006 · DOI: 10.1104/pp.105.072330
OsBRI1 Activates BR Signaling by Preventing Binding between the TPR and Kinase Domains of OsBSK3 via Phosphorylation.2016 · DOI: 10.1104/pp.15.01668
OsREM4.1 Interacts with OsSERK1 to Coordinate the Interlinking between Abscisic Acid and Brassinosteroid Signaling in Rice.2016 · DOI: 10.1016/j.devcel.2016.06.011
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_007580 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0001578 microtubule bundle formation Biological Process
GO:0009414 response to water deprivation Biological Process
GO:0009416 response to light stimulus Biological Process
GO:0009647 skotomorphogenesis Biological Process
GO:0009729 detection of brassinosteroid stimulus Biological Process
GO:0009742 brassinosteroid mediated signaling pathway Biological Process
GO:0009755 hormone-mediated signaling pathway Biological Process
GO:0009791 post-embryonic development Biological Process
GO:0009911 positive regulation of flower development Biological Process
GO:0010224 response to UV-B Biological Process
GO:0010268 brassinosteroid homeostasis Biological Process
GO:0010584 pollen exine formation Biological Process
KEGG gene cross-reference
ath:AT3G13380
ath:AT4G39400
dosa:Os01g0718300
sly:101261320
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.870
Rank 1 · LXL04_007580 · OH-1004
Endoplasmic reticulum0.089
Rank 2 · LXL04_007580 · OH-1004
Cytoplasm0.061
Rank 3 · LXL04_007580 · OH-1004
Nucleus0.047
Rank 4 · LXL04_007580 · OH-1004
Lysosome / Vacuole0.026
Rank 5 · LXL04_007580 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_229-63 aa
PF13855.13LRR_8169-223 aa
PF12799.14LRR_4169-204 aa
PF13855.13LRR_8190-249 aa
PF12799.14LRR_4214-251 aa
PF13855.13LRR_8260-321 aa
PF12799.14LRR_4285-325 aa
PF23598.2LRR_14305-537 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_007580PF08263.18LRRNT_229633e-0731.3
LXL04_007580PF13855.13LRR_81692235.3e-48161.3
LXL04_007580PF12799.14LRR_41692041.2e-40137.4
LXL04_007580PF13855.13LRR_81902495.3e-48161.3
LXL04_007580PF12799.14LRR_42142511.2e-40137.4
LXL04_007580PF13855.13LRR_82603215.3e-48161.3
LXL04_007580PF12799.14LRR_42853251.2e-40137.4
LXL04_007580PF23598.2LRR_143055371.2e-1454.5
LXL04_007580PF13855.13LRR_83103705.3e-48161.3
LXL04_007580PF12799.14LRR_43844201.2e-40137.4
LXL04_007580PF13855.13LRR_83854445.3e-48161.3
LXL04_007580PF13855.13LRR_84585155.3e-48161.3
LXL04_007580PF13855.13LRR_84815405.3e-48161.3
LXL04_007580PF20141.5Island5536176.2e-30103.1
LXL04_007580PF13855.13LRR_86487045.3e-48161.3
LXL04_007580PF00069.32Pkinase84511142.9e-42145.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
O22476Arabidopsis thalianaProtein BRASSINOSTEROID INSENSITIVE 161.744%Swiss-Protstrong database homology
Q9LJF3Arabidopsis thalianaReceptor-like protein kinase BRI1-like 347.152%Swiss-Protmoderate database homology
Q942F3Oryza sativa subsp. japonicaBrassinosteroid LRR receptor kinase BRI152.957%Swiss-Protstrong database homology

JBrowse

View in Genome Browser