TkA03G178270 | RubberDandelionOmics

Gene overview

TkA03G178270

Reference: TK1151 Chr: Chr03 Coordinates: 45011925-45014521 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1407 bp · TkA03G178270|TK1151|cDNA

TTCGAGTGTAGACATACAAGGAGCGGGCCTAACTAGTAGTACATTAAAAACTAAAAATATATCCAAGTTATTGGGCTAAACATCCTTGTAATAACTGACCCGAGCCAATGCTCGATAGTAGATACTATTCCCTATGTCGCTCGAATTCTTGCTCCTTCAACAGAGCTATCTTCCTCCTTCTTCCCTGCTTTCATATCAAGGGCTTTAAAGTGAAATAACTGGAGTTGGAAATTGGATTAGTTGGTGGAAATGTCGTTACA...

CDS

Download CDS FASTA

1065 bp · TkA03G178270|TK1151|CDS

ATGCTCGATAGTAGATACTATTCCCTATGTCGCTCGAATTCTTGCTCCTTCAACAGAGCTATCTTCCTCCTTCTTCCCTGCTTTCATATCAAGTGTATTGGATTAAATATGTTGCCATTTTCCCAATCTGTATATGCAAAAGAGAACGTATTAAAAGCTAATCTTTCCTTCAATAAGGAGCCTTTTACAAGCGTTCAGTTTCCCAGATCACTGTTCCTGGCACAAACTTTGCAAAAAAGTAGATTGAGAGCTTCTAAAGT...

Protein

Download Protein FASTA

354 aa · TkA03G178270|TK1151|PROTEIN

MLDSRYYSLCRSNSCSFNRAIFLLLPCFHIKCIGLNMLPFSQSVYAKENVLKANLSFNKEPFTSVQFPRSLFLAQTLQKSRLRASKVEILDCDDDKKKESPKSSKKDDDEDDDDSDFEMDEEEREEFRKKIRQMIAMNPEVKGVDDPEEKKKMMEKLLSDYPLVVDEEDPDWPEDADGRGFNFSQFFDKMSIKNVKKDDDDDGYDSDGEVNWQDIKAIKDIKSEEWEDTVFQDLSPLIVLVHHRYKRPKENEMARDQLEK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G178270`
TK1151 ID	TkA03G178270
OH-1004 ID	LXL04_007452
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	92.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G178270

Location Chr03:45011925-45014521 (-)

Description Similar to MRL7L: Thioredoxin-like fold domain-containing protein MRL7L, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g31840`	Plays an essential role in early steps of chloroplast development.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0417200`	Plays an essential role in early steps of chloroplast development.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007452 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009266 response to temperature stimulus Biological Process

GO:0009646 response to absence of light Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0042644 chloroplast nucleoid Cellular Component

KEGG gene cross-reference

ath:AT2G31840

ath:AT4G28590

dosa:Os01g0829000

dosa:Os05g0417200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.941

Rank 1 · TkA03G178270 · TK1151

Mitochondrion0.056

Rank 2 · TkA03G178270 · TK1151

Nucleus0.041

Rank 3 · TkA03G178270 · TK1151

Cytoplasm0.024

Rank 4 · TkA03G178270 · TK1151

Cell membrane0.014

Rank 5 · TkA03G178270 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17658DUF552066-143 aa

PF27705UCP01005680-132 aa

PF00085Thioredoxin84-102 aa

PF12174RST117-134 aa

PF12174RST239-265 aa

PF00085Thioredoxin276-323 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G178270	`PF17658`	DUF5520	66	143	0.13	12.1
TkA03G178270	`PF27705`	UCP010056	80	132	0.96	9.5
TkA03G178270	`PF00085`	Thioredoxin	84	102	0.012	16.4
TkA03G178270	`PF12174`	RST	117	134	0.67	10.6
TkA03G178270	`PF12174`	RST	239	265	0.67	10.6
TkA03G178270	`PF00085`	Thioredoxin	276	323	0.012	16.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SKB6`	Arabidopsis thaliana	sp\|Q9SKB6\|MRL7L_ARATH Thioredoxin-like fold domain-containing protein MRL7L, chloroplastic	59.400%	Swiss-Prot	High
`Q0DI48`	Oryza sativa subsp. japonica	sp\|Q0DI48\|MRL7L_ORYSJ Thioredoxin-like fold domain-containing protein MRL7L homolog, chloroplastic	53.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card